SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16078547|ref|NP_389366.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078547|ref|NP_389366.1|
Domain Number 1 Region: 8-309
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.09e-116
Family Glutaminase 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16078547|ref|NP_389366.1|
Sequence length 309
Comment glutaminase [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MVCQHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
Download sequence
Identical sequences A0A125UHB9 A0A164SJI7 A0A1B2B472 L8AJA9 M4KRC8 O07637
NP_389366.1.22788 WP_003245206.1.101301 WP_003245206.1.11257 WP_003245206.1.1140 WP_003245206.1.12759 WP_003245206.1.15902 WP_003245206.1.16291 WP_003245206.1.19261 WP_003245206.1.20502 WP_003245206.1.25531 WP_003245206.1.27372 WP_003245206.1.27660 WP_003245206.1.2914 WP_003245206.1.31028 WP_003245206.1.31260 WP_003245206.1.32219 WP_003245206.1.32420 WP_003245206.1.33846 WP_003245206.1.36189 WP_003245206.1.3747 WP_003245206.1.39605 WP_003245206.1.40859 WP_003245206.1.44140 WP_003245206.1.44184 WP_003245206.1.45019 WP_003245206.1.47157 WP_003245206.1.54949 WP_003245206.1.56274 WP_003245206.1.56411 WP_003245206.1.57201 WP_003245206.1.5726 WP_003245206.1.57513 WP_003245206.1.6139 WP_003245206.1.6517 WP_003245206.1.65223 WP_003245206.1.72999 WP_003245206.1.76977 WP_003245206.1.78686 WP_003245206.1.78811 WP_003245206.1.79712 WP_003245206.1.81116 WP_003245206.1.81747 WP_003245206.1.82722 WP_003245206.1.88042 WP_003245206.1.91060 WP_003245206.1.91133 WP_003245206.1.91723 WP_003245206.1.93420 WP_003245206.1.94199 WP_003245206.1.95009 WP_003245206.1.96043 WP_003245206.1.979 WP_003245206.1.99091 gi|449094179|ref|YP_007426670.1| gi|16078547|ref|NP_389366.1| gi|560128574|ref|YP_008829715.1| gi|402775727|ref|YP_006629671.1| 224308.BSU14830 APC1301 SR164 gi|470161662|ref|YP_007533437.1| gi|472330012|ref|YP_007662288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]