SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16078758|ref|NP_389577.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078758|ref|NP_389577.1|
Domain Number 1 Region: 84-380
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.19e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16078758|ref|NP_389577.1|
Sequence length 391
Comment penicillin-binding protein PbpX [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MTSPTRRRTAKRRRRKLNKRGKLLFGLLAVMVCITIWNALHRNSEENEPSQETAAVSNTD
QKKEVKKKTAKKSEEQIKTVDRNQKISNYLKEIGFSGTAMIVRNGEIVTNKGFGYADRKH
YIQNNPLTSFYVGSSQKALIATAILQLEEKGKLQTSDPVSTYLPHFPNGQTITLKNLLTH
TSGINGHIEGNGAITPDDLIKDIELQGIKRQPGVWDYKDSNYSVLAYIIAEVSGEPYEQY
IKNHIFKPAGMTHAGFYKTYEKEPYPAVGYKMEGSKTVTPYIPDLSQLYGAGDIYMSAID
MYKFDQALIDGKLYSQKSYEKMFTPGSSSTYGMGFYVAPGSYSNHGVMPGFNILNSFSKS
GQTIVILFSNIQNNAKLGQVNNKIYQLLNQE
Download sequence
Identical sequences A0A125UJB7 A0A164SDV1 A0A1B2B419 O31773
NP_389577.1.22788 WP_003245877.1.101301 WP_003245877.1.11257 WP_003245877.1.1140 WP_003245877.1.11581 WP_003245877.1.12759 WP_003245877.1.15902 WP_003245877.1.16291 WP_003245877.1.19261 WP_003245877.1.25531 WP_003245877.1.27372 WP_003245877.1.27660 WP_003245877.1.2914 WP_003245877.1.32219 WP_003245877.1.32420 WP_003245877.1.33846 WP_003245877.1.36189 WP_003245877.1.39605 WP_003245877.1.40859 WP_003245877.1.44140 WP_003245877.1.44184 WP_003245877.1.45019 WP_003245877.1.47157 WP_003245877.1.56274 WP_003245877.1.56411 WP_003245877.1.57184 WP_003245877.1.57201 WP_003245877.1.5726 WP_003245877.1.57513 WP_003245877.1.6139 WP_003245877.1.6517 WP_003245877.1.65223 WP_003245877.1.72999 WP_003245877.1.76977 WP_003245877.1.78686 WP_003245877.1.79046 WP_003245877.1.79712 WP_003245877.1.81116 WP_003245877.1.81747 WP_003245877.1.82722 WP_003245877.1.88042 WP_003245877.1.91723 WP_003245877.1.93420 WP_003245877.1.94199 WP_003245877.1.95009 WP_003245877.1.96043 WP_003245877.1.979 gi|560128790|ref|YP_008829931.1| gi|402775938|ref|YP_006629882.1| 224308.BSU16950 gi|16078758|ref|NP_389577.1| gi|470161874|ref|YP_007533649.1| NYSGRC-FDAO-CAB13568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]