SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16078940|ref|NP_389761.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078940|ref|NP_389761.1|
Domain Number 1 Region: 51-302
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.45e-75
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16078940|ref|NP_389761.1|
Sequence length 306
Comment beta-lactamase [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKLKTKASIKFGICVGLLCLSITGFTPFFNSTHAEAKSIEDTNMASCITNKKFVQLEKKF
DARLGVYAIDIGSNKTIAYRPNERFAYASTYKVLAAAAVLKKNSIEKLNEVIHYSKDDLV
TYSPITEKHLDTGMSLKEISEAAIRYSDNTAGNILLQQLGGPKGFEKSLKQIGDHVTKAK
RFETDLNSAIPGDIRDTSTAKALATDLKAFTLDNTLTTDKRMILTDWMRGNATGDELIRA
GAPIGWEVGDKSGAGSYGTRNDIAIVWPPNRAPIVVAILSNRFTKDANYDNALIAEAAKV
VLNDLK
Download sequence
Identical sequences A0A162SIF4 G4EVI7 L8ALW2 P39824
gi|470162066|ref|YP_007533841.1| gi|560128991|ref|YP_008830132.1| 224308.BSU18800 gi|402776125|ref|YP_006630069.1| NYSGRC-FDAO-CAB13772 NP_389761.1.22788 WP_003231385.1.11257 WP_003231385.1.1140 WP_003231385.1.12759 WP_003231385.1.15902 WP_003231385.1.16291 WP_003231385.1.19261 WP_003231385.1.27372 WP_003231385.1.27660 WP_003231385.1.2914 WP_003231385.1.32219 WP_003231385.1.32420 WP_003231385.1.33846 WP_003231385.1.36189 WP_003231385.1.39605 WP_003231385.1.40859 WP_003231385.1.44140 WP_003231385.1.44184 WP_003231385.1.45019 WP_003231385.1.47157 WP_003231385.1.56274 WP_003231385.1.56411 WP_003231385.1.57184 WP_003231385.1.57201 WP_003231385.1.5726 WP_003231385.1.57513 WP_003231385.1.6139 WP_003231385.1.6517 WP_003231385.1.65223 WP_003231385.1.72999 WP_003231385.1.76977 WP_003231385.1.78686 WP_003231385.1.81116 WP_003231385.1.81747 WP_003231385.1.82722 WP_003231385.1.88042 WP_003231385.1.91723 WP_003231385.1.93420 WP_003231385.1.94199 WP_003231385.1.96043 WP_003231385.1.979 gi|16078940|ref|NP_389761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]