SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16079289|ref|NP_390113.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079289|ref|NP_390113.1|
Domain Number 1 Region: 241-263,298-700
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.13e-105
Family beta-Lactamase/D-ala carboxypeptidase 0.00000192
Further Details:      
 
Domain Number 2 Region: 72-278
Classification Level Classification E-value
Superfamily Lysozyme-like 3.94e-73
Family PBP transglycosylase domain-like 0.00000298
Further Details:      
 
Domain Number 3 Region: 717-787
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000236
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16079289|ref|NP_390113.1|
Sequence length 914
Comment penicillin-binding protein 1A/1B [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSDQFNSREARRKANSKSSPSPKKGKKRKKGGLFKKTLFTLLILFVLGVVGGAVTFAVMV
SDAPSLDESKLKTPYSSTIYDKNGKEIAEVGAEKRTYVSIDEIPDVVKEAFIATEDARFY
EHHGIDPVRIGGALVANFKDGFGAEGGSTITQQVVKNSLLSHQKTLKRKVQEVWLSIQLE
RNYSKDEILEMYLNRIYFSPRAYGIGKAAEEFFGVTDLSKLTVEQAATLAGMPQSPTAYN
PVKNPDKAEKRRNIVLSLMKKQGFISDSQYNKAKKVAVKDEGVVSQKEYEKASTNKYSAF
VEEVMKEIDEKSDVDPSADGLKIYTTLDTKAQDKLDELMDGDTVGFTEGMQGGVTLLDTK
NGEVRAIGAGRNQPVGGFNYATQTKAQPGSTIKPILDYGPVIENKKWSTYEQIDDSAYTY
SNGKPIRDWDRKYLGPISMRYALAQSRNIPALKAFQAVGKDTAVDFANGLGLGLTKDNVT
EAYSIGGFGGNDGVSPLTMAGAYSAFGNNGTYNEPHFVKSIEFNDGTKLDLTPKSKSAMS
DYTAFMITDMLKTAVKTGTGQLAQVPGVEVAGKTGTTNFDDNEVKRYNIASGGARDSWFV
GYTPQYTAAVWTGMGENEAGKKSLSAEEQKVAKRIFAQLIADVDDGSGSFEKPDSVVEAT
VEKGSNPAKLAGPNTPSDKKLTEYFVKGTAPSTVSKTYEKEEKEETAKLSGLNVKYDKDN
QSLTLSWNYDGDATFAVKQSVDGGSYSEIQNSSAKEAVISGVQPGSVYKFEVTAVSDDGK
STASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTN
DQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTS
NKTQTNSSSIEKTN
Download sequence
Identical sequences A0A164XEE6 A0A1B2AX17 A0A1Y0WUG0 D4FXZ8 L8AJ83 P39793
gi|560129172|ref|YP_008830313.1| gi|402776490|ref|YP_006630434.1| gi|470162435|ref|YP_007534210.1| NP_390113.1.22788 WP_004398589.1.11257 WP_004398589.1.1140 WP_004398589.1.12759 WP_004398589.1.15902 WP_004398589.1.16291 WP_004398589.1.19261 WP_004398589.1.27372 WP_004398589.1.27612 WP_004398589.1.27660 WP_004398589.1.2914 WP_004398589.1.32219 WP_004398589.1.33285 WP_004398589.1.33846 WP_004398589.1.36189 WP_004398589.1.39605 WP_004398589.1.40859 WP_004398589.1.44140 WP_004398589.1.44184 WP_004398589.1.45019 WP_004398589.1.47157 WP_004398589.1.51783 WP_004398589.1.52847 WP_004398589.1.55792 WP_004398589.1.56274 WP_004398589.1.56411 WP_004398589.1.57201 WP_004398589.1.5726 WP_004398589.1.57513 WP_004398589.1.6139 WP_004398589.1.6517 WP_004398589.1.65223 WP_004398589.1.67028 WP_004398589.1.72999 WP_004398589.1.76977 WP_004398589.1.78686 WP_004398589.1.78811 WP_004398589.1.79288 WP_004398589.1.79712 WP_004398589.1.81116 WP_004398589.1.81747 WP_004398589.1.82722 WP_004398589.1.84434 WP_004398589.1.88042 WP_004398589.1.91723 WP_004398589.1.93420 WP_004398589.1.94199 WP_004398589.1.95009 WP_004398589.1.96043 WP_004398589.1.979 gi|428279697|ref|YP_005561432.1| gi|16079289|ref|NP_390113.1| 224308.BSU22320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]