SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16079376|ref|NP_390200.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079376|ref|NP_390200.1|
Domain Number 1 Region: 1-267
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.8e-70
Family beta-Lactamase/D-ala carboxypeptidase 0.0000871
Further Details:      
 
Weak hits

Sequence:  gi|16079376|ref|NP_390200.1|
Domain Number - Region: 259-352
Classification Level Classification E-value
Superfamily Penicillin-binding protein associated domain 0.000194
Family PBP5 C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16079376|ref|NP_390200.1|
Sequence length 382
Comment D-alanyl-D-alanine carboxypeptidase DacB [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MRIFKKAVFVIMISFLIATVNVNTAHAAIDVSAKSAIIIDGASGRVLYAKDEHQKRRIAS
ITKIMTAVLAIESGKMDQTVTVSANAVRTEGSAIYLTEGQKVKLKDLVYGLMLRSGNDAA
VAIAEHVGGSLDGFVYMMNQKAEQLGMKNTRFQNPHGLDDHENHYSTAYDMAILTKYAMK
LKDYQKISGTKIYKAETMESVWKNKNKLLTMLYPYSTGGKTGYTKLAKRTLVSTASKDGI
DLIAVTINDPNDWDDHMKMFNYVFEHYQTYLIAKKGDIPKLKGTFYESKAFIKRDITYLL
TEEEKENVKINTTLLKPKKAWEKDASKIPDIVGHMEIMFNDATIAKVPIYYENERHQKPK
KQFFETFKSIFLNAAGGAKWSI
Download sequence
Identical sequences A0A0T8PSU8 A0A164XC30 A0A1B2B4X3 G4EUB4 L8AMM2 P35150
gi|402776579|ref|YP_006630523.1| gi|321311791|ref|YP_004204078.1| gi|470162524|ref|YP_007534299.1| NP_390200.1.22788 WP_003230505.1.11257 WP_003230505.1.1140 WP_003230505.1.12759 WP_003230505.1.15902 WP_003230505.1.16291 WP_003230505.1.18944 WP_003230505.1.19261 WP_003230505.1.20099 WP_003230505.1.23108 WP_003230505.1.27372 WP_003230505.1.27660 WP_003230505.1.2914 WP_003230505.1.32025 WP_003230505.1.32219 WP_003230505.1.32420 WP_003230505.1.32693 WP_003230505.1.33846 WP_003230505.1.36189 WP_003230505.1.39605 WP_003230505.1.40859 WP_003230505.1.44140 WP_003230505.1.44184 WP_003230505.1.45019 WP_003230505.1.47157 WP_003230505.1.52860 WP_003230505.1.56274 WP_003230505.1.56411 WP_003230505.1.57184 WP_003230505.1.57201 WP_003230505.1.5726 WP_003230505.1.57513 WP_003230505.1.6139 WP_003230505.1.64889 WP_003230505.1.6517 WP_003230505.1.65188 WP_003230505.1.65223 WP_003230505.1.72999 WP_003230505.1.74782 WP_003230505.1.76977 WP_003230505.1.78686 WP_003230505.1.78811 WP_003230505.1.79712 WP_003230505.1.80832 WP_003230505.1.81116 WP_003230505.1.81747 WP_003230505.1.82722 WP_003230505.1.88042 WP_003230505.1.89821 WP_003230505.1.91723 WP_003230505.1.93073 WP_003230505.1.93420 WP_003230505.1.94199 WP_003230505.1.96043 WP_003230505.1.97264 WP_003230505.1.979 224308.BSU23190 gi|16079376|ref|NP_390200.1| gi|560129263|ref|YP_008830404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]