SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16079405|ref|NP_390229.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079405|ref|NP_390229.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.13e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.0000166
Further Details:      
 
Domain Number 2 Region: 280-373
Classification Level Classification E-value
Superfamily Penicillin-binding protein associated domain 1.59e-22
Family PBP5 C-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16079405|ref|NP_390229.1|
Sequence length 389
Comment D-alanyl-D-alanine carboxypeptidase DacF [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKRLLSTLLIGIMLLTFAPSAFAKQDGKRTSELAHEAKSAVLIERDTGKVLYNKNSNERL
APASMTKIMTMLLIMEALDKGKIKMSDKVRTSEHAASMGGSQIFLEPGEEMTVKEMLKGI
AIASGNDASVAMAEFISGSEEEFVKKMNKKAKELGLKNTSFKNPTGLTEEGHYSSAYDMA
IMAKELLKYESITKFTGTYEDYLRENTDKKFWLVNTNRLIKFYPGVDGVKTGYTGEAKYC
LTASAKKGNMRAIAVVFGASTPKERNAQVTKMLDFAFSQYETHPLYKRNQTVAKVKVKKG
KQKFIELTTSEPISILTKKGEDMNDVKKEIKMKDNISAPIQKGQELGTLVLKKDGEVLAE
SPVAAKEDMKKAGFITFLKRTMGDWTKFK
Download sequence
Identical sequences A0A125UJK6 A0A164XB83 A0A1B2BCW4 L8AN28 P38422
gi|402776608|ref|YP_006630552.1| 224308.BSU23480 gi|16079405|ref|NP_390229.1| gi|470162554|ref|YP_007534329.1| NP_390229.1.22788 WP_004398637.1.101301 WP_004398637.1.11257 WP_004398637.1.1140 WP_004398637.1.12759 WP_004398637.1.14761 WP_004398637.1.15902 WP_004398637.1.16291 WP_004398637.1.18944 WP_004398637.1.19261 WP_004398637.1.20099 WP_004398637.1.25531 WP_004398637.1.27372 WP_004398637.1.27660 WP_004398637.1.2914 WP_004398637.1.32219 WP_004398637.1.32861 WP_004398637.1.33846 WP_004398637.1.34621 WP_004398637.1.36189 WP_004398637.1.37074 WP_004398637.1.39605 WP_004398637.1.40859 WP_004398637.1.44140 WP_004398637.1.44184 WP_004398637.1.45019 WP_004398637.1.47157 WP_004398637.1.56274 WP_004398637.1.56411 WP_004398637.1.57184 WP_004398637.1.57201 WP_004398637.1.5726 WP_004398637.1.57513 WP_004398637.1.6139 WP_004398637.1.63795 WP_004398637.1.6517 WP_004398637.1.65188 WP_004398637.1.65223 WP_004398637.1.65841 WP_004398637.1.72999 WP_004398637.1.76977 WP_004398637.1.78686 WP_004398637.1.78811 WP_004398637.1.79712 WP_004398637.1.79987 WP_004398637.1.81116 WP_004398637.1.81747 WP_004398637.1.82722 WP_004398637.1.88042 WP_004398637.1.88382 WP_004398637.1.91723 WP_004398637.1.93420 WP_004398637.1.94199 WP_004398637.1.95009 WP_004398637.1.96043 WP_004398637.1.979 NYSGRC-FDAO-CAB14280 gi|560129292|ref|YP_008830433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]