SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16079742|ref|NP_390566.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079742|ref|NP_390566.1|
Domain Number 1 Region: 16-277
Classification Level Classification E-value
Superfamily Lysozyme-like 1.6e-87
Family Chitosanase 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16079742|ref|NP_390566.1|
Sequence length 277
Comment chitosanase [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKISMQKADFWKKAAISLLVFTMFFTLMMSETVFAAGLNKDQKRRAEQLTSIFENGTTEI
QYGYVERLDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPELRRLAKEESD
DTSNLKGFASAWKSLANDKEFRAAQDKVNDHLYYQPAMKRSDNAGLKTALARAVMYDTVI
QHGDGDDPDSFYALIKRTNKKAGGSPKDGIDEKKWLNKFLDVRYDDLMNPANHDTRDEWR
ESVARVDVLRSIAKENNYNLNGPIHVRSNEYGNFVIK
Download sequence
Identical sequences A0A125ULS7 B9W6G0 G4ET86 L8AM84 O07921
gi|430755821|ref|YP_007208808.1| gi|560129645|ref|YP_008830786.1| NP_390566.1.22788 WP_003229851.1.101301 WP_003229851.1.11231 WP_003229851.1.11257 WP_003229851.1.1140 WP_003229851.1.11581 WP_003229851.1.12759 WP_003229851.1.15902 WP_003229851.1.16291 WP_003229851.1.19261 WP_003229851.1.25531 WP_003229851.1.27372 WP_003229851.1.27660 WP_003229851.1.2914 WP_003229851.1.31028 WP_003229851.1.31100 WP_003229851.1.32219 WP_003229851.1.32420 WP_003229851.1.33846 WP_003229851.1.36189 WP_003229851.1.39605 WP_003229851.1.40859 WP_003229851.1.44140 WP_003229851.1.44184 WP_003229851.1.45019 WP_003229851.1.47157 WP_003229851.1.56274 WP_003229851.1.56411 WP_003229851.1.57184 WP_003229851.1.57201 WP_003229851.1.5726 WP_003229851.1.57513 WP_003229851.1.6139 WP_003229851.1.63795 WP_003229851.1.6517 WP_003229851.1.65223 WP_003229851.1.7186 WP_003229851.1.72516 WP_003229851.1.72999 WP_003229851.1.76977 WP_003229851.1.78686 WP_003229851.1.79712 WP_003229851.1.81116 WP_003229851.1.81747 WP_003229851.1.82722 WP_003229851.1.88042 WP_003229851.1.91723 WP_003229851.1.93420 WP_003229851.1.94199 WP_003229851.1.95009 WP_003229851.1.96043 WP_003229851.1.979 gi|16079742|ref|NP_390566.1| gi|470162898|ref|YP_007534673.1| 224308.BSU26890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]