SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16079869|ref|NP_390695.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079869|ref|NP_390695.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 6.54e-47
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 162-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.69e-39
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 6.54e-17
Family Glutamyl tRNA-reductase dimerization domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16079869|ref|NP_390695.1|
Sequence length 455
Comment glutamyl-tRNA reductase [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MHILVVGVDYKSAPIEIREKVSFQPNELAEAMVQLKEEKSILENIIVSTCNRTEIYAVVD
QLHTGRYYIKKFLADWFQLSKEELSPFLTFYESDAAVEHLFRVACGLDSMVIGETQILGQ
VRDSFKTAQQEKTIGTIFNELFKQAVTVGKRTHAETDIGSNAVSVSYAAVELAKKIFGNL
SSKHILILGAGKMGELAAENLHGQGIGKVTVINRTYLKAKELADRFSGEARSLNQLESAL
AEADILISSTGASEFVVSKEMMENANKLRKGRPLFMVDIAVPRDLDPALNDLEGVFLYDI
DDLEGIVEANMKERRETAEKVELLIEETIVEFKQWMNTLGVVPVISALREKALAIQSETM
DSIERKLPHLSTREKKLLNKHTKSIINQMLRDPILKVKELAADADSEEKLALFMQIFDIE
EAAGRQMMKTVESSQKVHSFKKAESKAGFSPLVSE
Download sequence
Identical sequences A0A0T8PJS0 A0A164WWY7 A0A1B2AXQ5 A0A1X7F9K3 A0A1Y0WX95 A0A285KRR9 L8AKU1 P16618
224308.BSU28170 gi|470163031|ref|YP_007534806.1| gi|472331166|ref|YP_007663442.1| gi|560129785|ref|YP_008830926.1| NP_390695.1.22788 WP_004399038.1.101301 WP_004399038.1.11231 WP_004399038.1.11257 WP_004399038.1.1140 WP_004399038.1.12644 WP_004399038.1.12759 WP_004399038.1.1358 WP_004399038.1.14761 WP_004399038.1.15902 WP_004399038.1.16291 WP_004399038.1.18944 WP_004399038.1.19261 WP_004399038.1.20099 WP_004399038.1.20502 WP_004399038.1.21045 WP_004399038.1.2546 WP_004399038.1.25531 WP_004399038.1.27372 WP_004399038.1.27612 WP_004399038.1.27660 WP_004399038.1.2914 WP_004399038.1.31028 WP_004399038.1.31100 WP_004399038.1.31260 WP_004399038.1.31786 WP_004399038.1.32219 WP_004399038.1.32420 WP_004399038.1.32861 WP_004399038.1.33285 WP_004399038.1.33846 WP_004399038.1.34621 WP_004399038.1.36189 WP_004399038.1.37074 WP_004399038.1.3747 WP_004399038.1.39605 WP_004399038.1.40859 WP_004399038.1.43852 WP_004399038.1.44140 WP_004399038.1.44184 WP_004399038.1.45019 WP_004399038.1.47157 WP_004399038.1.47672 WP_004399038.1.51783 WP_004399038.1.52847 WP_004399038.1.52860 WP_004399038.1.54596 WP_004399038.1.54949 WP_004399038.1.55792 WP_004399038.1.56274 WP_004399038.1.57156 WP_004399038.1.57184 WP_004399038.1.57201 WP_004399038.1.5726 WP_004399038.1.57513 WP_004399038.1.6139 WP_004399038.1.6517 WP_004399038.1.65188 WP_004399038.1.65223 WP_004399038.1.65841 WP_004399038.1.67028 WP_004399038.1.69439 WP_004399038.1.7159 WP_004399038.1.72152 WP_004399038.1.72516 WP_004399038.1.72999 WP_004399038.1.74782 WP_004399038.1.76977 WP_004399038.1.78686 WP_004399038.1.78811 WP_004399038.1.79288 WP_004399038.1.79987 WP_004399038.1.80832 WP_004399038.1.81116 WP_004399038.1.81747 WP_004399038.1.82722 WP_004399038.1.84183 WP_004399038.1.84434 WP_004399038.1.87300 WP_004399038.1.88042 WP_004399038.1.88382 WP_004399038.1.90830 WP_004399038.1.91060 WP_004399038.1.91133 WP_004399038.1.91723 WP_004399038.1.93073 WP_004399038.1.93420 WP_004399038.1.94199 WP_004399038.1.95009 WP_004399038.1.96043 WP_004399038.1.97264 WP_004399038.1.979 WP_004399038.1.99091 WP_004399038.1.99399 gi|16079869|ref|NP_390695.1| gi|321312349|ref|YP_004204636.1| gi|428280275|ref|YP_005562010.1| APC37696 gi|402776974|ref|YP_006630918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]