SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16080396|ref|NP_391223.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16080396|ref|NP_391223.1|
Domain Number 1 Region: 146-344
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000537
Further Details:      
 
Domain Number 2 Region: 429-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.77e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000548
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.89e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.002
Further Details:      
 
Domain Number 4 Region: 346-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16080396|ref|NP_391223.1|
Sequence length 571
Comment sulfite reductase [NADPH] hemoprotein beta-component [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MVTKILKAPDGSPSDVERIKKESDYLRGTLKEVMLDRISAGIPDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVSTPEQWLVMDDLSQKYGNGTLKLTTRETFQMH
GILKWNMKKTIQTIHSALLDTIAACGDVNRNVMCASNPYQSEIHSEVYEWSKKLSDDLLP
RTRAYHEIWLDEERVAGTPEEEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAI
VEDGKLIGFNVAIGGGMGMTHGDTATYPQLAKVIGFCRPEQMYDVAEKTITIQRDYGNRS
VRKNARFKYTVDRLGLENVKEELENRLGWSLEEAKPYHFDHNGDRYGWVEGIEDKWHFTL
FVEGGRITDYDDYKLMTGLREIAKVHTGEFRLTANQNLMIANVSSDKKEEISALIEQYGL
TDGKHYSALRRSSMACVALPTCGLAMAEAERYLPTLLDKIEEIIDENGLRDQEITIRMTG
CPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEADILSELRILLSRY
AKEREEGEHFGDFVIRAGIIKATTDGTNFHD
Download sequence
Identical sequences A0A0T8PLV7 A0A162QN04 A0A1B2AZK5 A0A1Y0WY40 D4G1D2 L8AV40 O32213
gi|384176966|ref|YP_005558351.1| gi|430758052|ref|YP_007208155.1| gi|402777507|ref|YP_006631451.1| gi|560130348|ref|YP_008831489.1| gi|428280881|ref|YP_005562616.1| gi|16080396|ref|NP_391223.1| 224308.BSU33430 NP_391223.1.22788 WP_003243849.1.11257 WP_003243849.1.1140 WP_003243849.1.11581 WP_003243849.1.12759 WP_003243849.1.15902 WP_003243849.1.16291 WP_003243849.1.19261 WP_003243849.1.25531 WP_003243849.1.27372 WP_003243849.1.27612 WP_003243849.1.27660 WP_003243849.1.2914 WP_003243849.1.31028 WP_003243849.1.31786 WP_003243849.1.32219 WP_003243849.1.32420 WP_003243849.1.33285 WP_003243849.1.33846 WP_003243849.1.35833 WP_003243849.1.36189 WP_003243849.1.39605 WP_003243849.1.40859 WP_003243849.1.44140 WP_003243849.1.44184 WP_003243849.1.45019 WP_003243849.1.47157 WP_003243849.1.51783 WP_003243849.1.52847 WP_003243849.1.54948 WP_003243849.1.55792 WP_003243849.1.56274 WP_003243849.1.56411 WP_003243849.1.57201 WP_003243849.1.5726 WP_003243849.1.57513 WP_003243849.1.6139 WP_003243849.1.6517 WP_003243849.1.65223 WP_003243849.1.67028 WP_003243849.1.7186 WP_003243849.1.72999 WP_003243849.1.76814 WP_003243849.1.76977 WP_003243849.1.78686 WP_003243849.1.79046 WP_003243849.1.79288 WP_003243849.1.79712 WP_003243849.1.80832 WP_003243849.1.81116 WP_003243849.1.81747 WP_003243849.1.82722 WP_003243849.1.84434 WP_003243849.1.88042 WP_003243849.1.9164 WP_003243849.1.91723 WP_003243849.1.93420 WP_003243849.1.94199 WP_003243849.1.95009 WP_003243849.1.96043 WP_003243849.1.979 gi|470163563|ref|YP_007535338.1| APC66673.0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]