SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16080585|ref|NP_391412.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16080585|ref|NP_391412.1|
Domain Number - Region: 20-79
Classification Level Classification E-value
Superfamily FlgN-like 0.0536
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16080585|ref|NP_391412.1|
Sequence length 113
Comment flagellar protein FliT [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MNNIDQLYTETKSMLSHIQNTPESDELLKQIEDFVATRSELIQEISLPLSEEERKQMKLI
LTWDQLIVKEMERLKQSIATELQQMKRKRVMHTTYLNPYNNITIDGTYYDKRK
Download sequence
Identical sequences A0A085C4M7 A0A1D8FML8 L8AUI1 P39740
gi|430756686|ref|YP_007207965.1| NP_391412.1.22788 WP_003242603.1.100042 WP_003242603.1.11231 WP_003242603.1.11257 WP_003242603.1.1140 WP_003242603.1.11581 WP_003242603.1.12759 WP_003242603.1.15902 WP_003242603.1.16291 WP_003242603.1.18944 WP_003242603.1.19261 WP_003242603.1.20099 WP_003242603.1.21045 WP_003242603.1.25531 WP_003242603.1.27372 WP_003242603.1.27660 WP_003242603.1.2914 WP_003242603.1.31100 WP_003242603.1.32219 WP_003242603.1.32420 WP_003242603.1.32861 WP_003242603.1.33083 WP_003242603.1.33846 WP_003242603.1.34750 WP_003242603.1.36189 WP_003242603.1.37074 WP_003242603.1.39562 WP_003242603.1.39605 WP_003242603.1.40859 WP_003242603.1.42762 WP_003242603.1.44140 WP_003242603.1.44184 WP_003242603.1.45019 WP_003242603.1.47157 WP_003242603.1.54596 WP_003242603.1.56274 WP_003242603.1.56411 WP_003242603.1.57184 WP_003242603.1.57201 WP_003242603.1.5726 WP_003242603.1.57513 WP_003242603.1.6139 WP_003242603.1.62713 WP_003242603.1.6517 WP_003242603.1.65188 WP_003242603.1.65223 WP_003242603.1.65841 WP_003242603.1.7186 WP_003242603.1.72516 WP_003242603.1.72999 WP_003242603.1.76977 WP_003242603.1.78686 WP_003242603.1.78811 WP_003242603.1.79712 WP_003242603.1.79987 WP_003242603.1.81116 WP_003242603.1.81747 WP_003242603.1.82722 WP_003242603.1.87192 WP_003242603.1.88042 WP_003242603.1.88591 WP_003242603.1.89000 WP_003242603.1.91723 WP_003242603.1.92915 WP_003242603.1.93420 WP_003242603.1.94199 WP_003242603.1.95009 WP_003242603.1.95211 WP_003242603.1.96043 WP_003242603.1.979 WP_003242603.1.99399 gi|470163751|ref|YP_007535526.1| gi|16080585|ref|NP_391412.1| APC1746 SR481 224308.BSU35320 gi|402777696|ref|YP_006631640.1| gi|560130542|ref|YP_008831683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]