SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16080595|ref|NP_391422.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16080595|ref|NP_391422.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily FlgN-like 1.06e-17
Family FlgN-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16080595|ref|NP_391422.1|
Sequence length 160
Comment hypothetical protein BSU35420 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDR
IKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDAL
QFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA
Download sequence
Identical sequences A0A0T8PWF8 A0A125UN06 A0A164TXJ0 A0A1B2B799 G4EQN8 L8AUI9 P39808
NP_391422.1.22788 WP_003227999.1.101301 WP_003227999.1.11257 WP_003227999.1.1140 WP_003227999.1.11581 WP_003227999.1.12644 WP_003227999.1.12759 WP_003227999.1.1358 WP_003227999.1.15902 WP_003227999.1.16291 WP_003227999.1.19261 WP_003227999.1.23108 WP_003227999.1.25531 WP_003227999.1.27372 WP_003227999.1.27660 WP_003227999.1.2914 WP_003227999.1.32025 WP_003227999.1.32219 WP_003227999.1.32420 WP_003227999.1.32693 WP_003227999.1.32861 WP_003227999.1.33846 WP_003227999.1.36189 WP_003227999.1.37074 WP_003227999.1.39605 WP_003227999.1.40859 WP_003227999.1.44140 WP_003227999.1.44184 WP_003227999.1.45019 WP_003227999.1.47157 WP_003227999.1.52860 WP_003227999.1.56274 WP_003227999.1.56411 WP_003227999.1.57184 WP_003227999.1.57201 WP_003227999.1.5726 WP_003227999.1.57513 WP_003227999.1.6139 WP_003227999.1.64889 WP_003227999.1.6517 WP_003227999.1.65223 WP_003227999.1.65841 WP_003227999.1.7186 WP_003227999.1.72999 WP_003227999.1.76977 WP_003227999.1.78686 WP_003227999.1.79046 WP_003227999.1.80832 WP_003227999.1.81116 WP_003227999.1.81747 WP_003227999.1.82722 WP_003227999.1.87300 WP_003227999.1.88042 WP_003227999.1.89821 WP_003227999.1.90830 WP_003227999.1.91723 WP_003227999.1.93420 WP_003227999.1.94199 WP_003227999.1.95009 WP_003227999.1.96043 WP_003227999.1.979 224308.BSU35420 gi|470163761|ref|YP_007535536.1| gi|430756676|ref|YP_007207955.1| gi|560130552|ref|YP_008831693.1| gi|16080595|ref|NP_391422.1| 367104 gi|402777706|ref|YP_006631650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]