SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16080601|ref|NP_391428.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16080601|ref|NP_391428.1|
Domain Number 1 Region: 1-281
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.6e-96
Family DegV-like 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16080601|ref|NP_391428.1|
Sequence length 281
Comment protein DegV [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPT
TSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISC
LAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFI
GSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEA
AKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
Download sequence
Identical sequences A0A063XBD4 A0A125UN86 A0A1B2AZR5 L8AVG3 P32436
gi|430756670|ref|YP_007207949.1| 224308.BSU35480 gi|560130558|ref|YP_008831699.1| NP_391428.1.22788 WP_003244125.1.101301 WP_003244125.1.11088 WP_003244125.1.11257 WP_003244125.1.1140 WP_003244125.1.11581 WP_003244125.1.12759 WP_003244125.1.15902 WP_003244125.1.16291 WP_003244125.1.19261 WP_003244125.1.21045 WP_003244125.1.25531 WP_003244125.1.27372 WP_003244125.1.27660 WP_003244125.1.2914 WP_003244125.1.32219 WP_003244125.1.32420 WP_003244125.1.32861 WP_003244125.1.33846 WP_003244125.1.36189 WP_003244125.1.37074 WP_003244125.1.39605 WP_003244125.1.40859 WP_003244125.1.44140 WP_003244125.1.44184 WP_003244125.1.45019 WP_003244125.1.47157 WP_003244125.1.52860 WP_003244125.1.56274 WP_003244125.1.56411 WP_003244125.1.57201 WP_003244125.1.5726 WP_003244125.1.57513 WP_003244125.1.6139 WP_003244125.1.63795 WP_003244125.1.6517 WP_003244125.1.65223 WP_003244125.1.65841 WP_003244125.1.71402 WP_003244125.1.7186 WP_003244125.1.72999 WP_003244125.1.76977 WP_003244125.1.78686 WP_003244125.1.78811 WP_003244125.1.79712 WP_003244125.1.81116 WP_003244125.1.81747 WP_003244125.1.82722 WP_003244125.1.88042 WP_003244125.1.89000 WP_003244125.1.91723 WP_003244125.1.93420 WP_003244125.1.94199 WP_003244125.1.95009 WP_003244125.1.96043 WP_003244125.1.979 d3fysa1 gi|402777712|ref|YP_006631656.1| APC1757 gi|470163767|ref|YP_007535542.1| gi|16080601|ref|NP_391428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]