SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767043|ref|NP_388048.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767043|ref|NP_388048.2|
Domain Number 1 Region: 47-409
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.13e-75
Family beta-Lactamase/D-ala carboxypeptidase 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255767043|ref|NP_388048.2|
Sequence length 441
Comment hypothetical protein BSU01670 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKTKTLFIFSAILTLSIFAPNETFAQTAGNLIEPKIINAETAQFSTKKLRKVDQMIERDI
AAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPAKMKTRTMFDLASNTKMYATNF
ALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKDKIRVIDVLQHQSGLPSSFYFYTPE
KAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGYMLLGCIVEKLTGKPLDVYTEQEL
YKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGVIQFPNIRTNTLQGEVHDEKAFYSM
DGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLFDQKTADLFTAPSATDPTFALGWRRN
GSKSMEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIALLTNKKHTPVIDPEENPNVFE
GDQFPTGSYGSVITAIYEAME
Download sequence
Identical sequences A0A162RQR0 A0A1B2B962 G4F0N3 L8AC85 O05213
gi|402774410|ref|YP_006628354.1| NP_388048.2.22788 WP_003234970.1.11257 WP_003234970.1.1140 WP_003234970.1.12759 WP_003234970.1.15902 WP_003234970.1.16291 WP_003234970.1.19261 WP_003234970.1.27372 WP_003234970.1.27660 WP_003234970.1.32219 WP_003234970.1.32420 WP_003234970.1.33846 WP_003234970.1.36189 WP_003234970.1.39605 WP_003234970.1.40859 WP_003234970.1.44140 WP_003234970.1.44184 WP_003234970.1.45019 WP_003234970.1.47157 WP_003234970.1.56274 WP_003234970.1.56411 WP_003234970.1.57184 WP_003234970.1.57201 WP_003234970.1.5726 WP_003234970.1.6139 WP_003234970.1.65223 WP_003234970.1.72999 WP_003234970.1.76977 WP_003234970.1.78686 WP_003234970.1.81116 WP_003234970.1.81747 WP_003234970.1.82722 WP_003234970.1.88042 WP_003234970.1.91723 WP_003234970.1.93420 WP_003234970.1.94199 WP_003234970.1.96043 WP_003234970.1.979 gi|470160319|ref|YP_007532094.1| gi|560127193|ref|YP_008828334.1| 224308.BSU01670 gi|255767043|ref|NP_388048.2| NYSGRC-FDAO-CAB11943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]