SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767098|ref|NP_388214.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767098|ref|NP_388214.2|
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.55e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0022
Further Details:      
 
Domain Number 2 Region: 147-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 
Domain Number 3 Region: 495-600
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.018
Further Details:      
 
Domain Number 4 Region: 625-741
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-18
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255767098|ref|NP_388214.2|
Sequence length 771
Comment assimilatory nitrate reductase electron transfer subunit [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNRILLSSVLQGEASLDD
ITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDKLIVATGSSPHILPIPG
ADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVGLQHLGMDVSVIHHSAGI
MQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRIHFKDGSSLKADLIVMAAG
VKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEHNGTVYGLVAPLYEQGKALA
SHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTTSIKIYDEQAGVYKKALFVDD
KLAGVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPETSGPLFESMPSSETICQCNTVT
KGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVEDLLRYMTNSEYTKPASTPSFCSC
TDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCSTCVPAIQYYLEMLYPGFVQPEPAT
EETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVSITHGQRLKLSGIKPADLPNMKKDL
KMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIERQLEMLPLPAPISISLSCETDCTEA
ALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCVTENEDSTAGMIKGLIQYYRETAHYLE
GVHQWIDRLGIVHIREVLFEEDLRAQLLESLQTDLSLIQNPTVETGAYKKG
Download sequence
Identical sequences A0A164V7Q2 A0A1B2AT90 L8ACN2 P42433
224308.BSU03320 NP_388214.2.22788 WP_003246389.1.11257 WP_003246389.1.1140 WP_003246389.1.12759 WP_003246389.1.15902 WP_003246389.1.16291 WP_003246389.1.32219 WP_003246389.1.33846 WP_003246389.1.36189 WP_003246389.1.39605 WP_003246389.1.40859 WP_003246389.1.44184 WP_003246389.1.45019 WP_003246389.1.47157 WP_003246389.1.56274 WP_003246389.1.56411 WP_003246389.1.57201 WP_003246389.1.5726 WP_003246389.1.6139 WP_003246389.1.65223 WP_003246389.1.72999 WP_003246389.1.76977 WP_003246389.1.78686 WP_003246389.1.81116 WP_003246389.1.81747 WP_003246389.1.82722 WP_003246389.1.88042 WP_003246389.1.91723 WP_003246389.1.94199 WP_003246389.1.96043 WP_003246389.1.979 gi|255767098|ref|NP_388214.2| gi|560127364|ref|YP_008828505.1| gi|470160482|ref|YP_007532257.1| gi|402774572|ref|YP_006628516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]