SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767293|ref|NP_389150.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767293|ref|NP_389150.2|
Domain Number 1 Region: 1114-1187
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000000000141
Family Bacterial muramidase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255767293|ref|NP_389150.2|
Sequence length 1332
Comment phage-like element PBSX protein XkdO [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MAKLTARFDLEDKVSKKLKRIHKGFQEVEKKVKTINRQIKISIRAEDQAFYRLRKINDYI
ILKFAKSLEIKVVLDDQVTSKLDAIERKLKRLPKETKLTVSLVDRTAAAYKKIKKMLSNQ
KLSFLLIPDDKVTSTVKRIIGYIKKNLKNGYTVKLKVIDEITKTVNRLTALLRKFEKTYY
VKVVVKTKISDKINKKESLINKETSKKESDKSSDKGSDKNSDQKPGWVGKIKGWLKDWWT
KSAWPWIKDTLNEIGKAFLDRFKERLIEKLKNDVFDKIIDKILGPQKKDDSGENSDTDKK
VLNRNTGGNCCCDCCEGGISPGTKNKKTYRKKKSPTKAPNRTLKVPGEVIRRRQSGTPAE
SAPRTSGSKLKNWLGGLKSLGKDSSKLGKAFRGMGKAVPYVGSALAVFDLAGINKDNAGE
KVGSIGGRIAGAEAGATAGAEAGATIGSFVGPEGTAIGGAIGGIGGGLVGGIGGEEAGKN
IGKMFDTSKLKESISNSLFNKEWWSGKWNSISDTANGAITWIEDTWSKVSTWFDQYVFTP
IYNVAVPVINFIVGLFAYAWDGILAVWNIVYPWFKDNVWDPISGAVTNVATTIWTGLCNA
WTVISGIWSTVSTWFMDNVWNPVSEAVTTAATWIWSKINDAWTIISNIWTGVSNWFYDNV
WNPIVKKVEDIKTSIKEKFDDARKFFEDAWDGIETWFNEHVKDPLVKVSEKIAEKFQWLF
DLKDSVGGFVAKVIHRGEEVTHLKKKPIKKDSKEKKTSSKPTTNNIFAQSPSNNNMTVFQ
QALDQNATGGYITKPTISWIGEAGKEFVIPVDNNRGRGKMLLSQAASKLGMQVVDDMGAA
SSSGGSPASVSGGAAVSPLSGTASPVMNTANLTGQASTLGQQFSEGFGKGISDQPVKMED
WKKKNINTPFTQMISASPNYGKQMVSGYAKGQSGTATGTDGFLQSKVKTPFQATVSKSSS
WGTGTVKGFAQGQNSTQTGTAQYVSTHVDKPFLRSKDTSNSWGSGLIGNFVTGMNSKSSE
VKQAAKDMAKRVEQAFREELDIHSPSRVMMSLGRFASVGVVKGLDSVDVKKYAEKQAGSL
AAAYSGMGAVGGNVKQWLMAAIMATKTPLSWLSGLMTIAQYESGGNPNSINLWDSNAKAG
NPSQGLMQTVPTTFNAHKAPGMGNIRNPIHNAAAAIGYIKSRYGSIDNVPGIKSLKRGGP
YVGYANGGLITKEQIARVGEGNKREWIIPEERGIRGRYLLQRAAQALGMEVTDPSQSQQS
ELSSGQVSAVTSASRPTAAVSGSKEIYIQFNGDQHFHNGQDAESLAAKIKQALIDELQKD
INIGTKGVVAFD
Download sequence
Identical sequences P54334
224308.BSU12680 gi|255767293|ref|NP_389150.2| NP_389150.2.22788 WP_010886493.1.11257 WP_010886493.1.1140 WP_010886493.1.12759 WP_010886493.1.15902 WP_010886493.1.16291 WP_010886493.1.19261 WP_010886493.1.27372 WP_010886493.1.32219 WP_010886493.1.33846 WP_010886493.1.36189 WP_010886493.1.39605 WP_010886493.1.40859 WP_010886493.1.44140 WP_010886493.1.44184 WP_010886493.1.45019 WP_010886493.1.47157 WP_010886493.1.56274 WP_010886493.1.56411 WP_010886493.1.57201 WP_010886493.1.5726 WP_010886493.1.65223 WP_010886493.1.72999 WP_010886493.1.76977 WP_010886493.1.78686 WP_010886493.1.78811 WP_010886493.1.79712 WP_010886493.1.81116 WP_010886493.1.81747 WP_010886493.1.82722 WP_010886493.1.88042 WP_010886493.1.91723 WP_010886493.1.94199 WP_010886493.1.96043 WP_010886493.1.979 gi|470161438|ref|YP_007533213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]