SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767473|ref|NP_390018.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767473|ref|NP_390018.2|
Domain Number 1 Region: 1414-1541
Classification Level Classification E-value
Superfamily Lysozyme-like 5.93e-50
Family Bacterial muramidase, catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1541-1678
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.09e-38
Family Peptidoglycan hydrolase LytM 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255767473|ref|NP_390018.2|
Sequence length 2285
Comment transglycosylase YomI [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSQNLKIILTPQADTSSKTVEQLNQQIKSLEKKLNSLKLNTNIDSTTLKALQEFSSAIDT
YQKNLKSYNQTVKETSTVIKNADGSVEKLTQQYKKNGEILQRETKIINNRNTALKQETQE
VNKLTQATEKLGQVQKKTVQRNLQGQPTKVVQKNRHGFDDIVYTTDPKTNSTSSKTTTNY
DQQRRAIEQLKQDLEKLRQQGIVTDTTISSLGRKINTAQSAQQIEALQNRIRMLDDKSAA
VAKNNELKKTIELYQRQAQVNVQNLNTRYGSSMGSSNRQAVQDYLNAVNSLNVSTGSNNI
RSQIQSLNMQFRELASNAQTAANQASSFGAELTQTFKSMSTYLISGSLFYGAISGLKEMV
SQAIEIDTLMTNIRRVMNEPDYKYNELLQESIDLGDTLSNKITDILQMTGDFGRMGFDES
ELSTLTKTAQVLQNVSDLTPDDTVNTLTAAMLNFNIAANDSISIADKLNEVDNNYAVTTL
DLANSIRKAGSTASTFGVELNDLIGYTTAIASTTRESGNIVGNSLKTIFARIGNNQSSIK
ALEQIGISVKTAGGEAKSASDLISEVAGKWDTLSDAQKQNTSIGVAGIYQLSRFNAMMNN
FSIAQNAAKTAANSTGSAWSEQQKYADSLQARVNKLQNNFTEFAIAASDAFISDGLIEFT
QAAGSLLNASTGVIKSVGFLPPLLAAVSTATLLLSKNTRTLASSLILGTRAMGQETLATA
GLEAGMTRAAVASRVLKTALRGLLVSTLVGGAFAALGWALESLISSFAEAKKAKDDFEQS
QQTNVEAITTNKDSTDKLIQQYKELQKVKESRSLTSDEEQEYLQVTQQLAQTFPALVKGY
DSQGNAILKTNKELEKAIENTKEYLALKKQETRDSAKKTFEDASKEIKKSKDELKQYKQI
ADYNDKGRPKWDLIADDDDYKVAADKAKQSMLKAQSDIESGNAKVKDSVLSIANAYSSID
ISNTLKTSISDVVNKLNLKDDLDPEELEKFSSSLGKLQEKMQKALDSGDEKAFDNAKKDL
QSLLETYSKSDSSIDVFKMSFDKAQKNIKDGDKSLSSVKSEVGDLGETLAEAGNEAEDFG
KKLKEALDANSVDDIKAAIKEMSDAMQFDSVQDVLNGDIFNNTKDQVAPLNDLLEKMAEG
KSISANEANTLIQKDKELAQAISIENGVVKINRDEVIKQRKVKLDAYNDMVTYSNKLMKT
EVNNAIKTLNADTLRIDSLKKLRKERKLDMSEAELSDLEVKSINNVADAKKELKKLEEKM
LQPGGYSNSQIEAMQSVKSALESYISASEEATSTQEMNKQALVEAGTSLENWTDQQEKAN
EETKTSMYVVDKYKEALEKVNAEIDKYNKQVNDYPKYSQKYRDAIKKEIKALQQKKKLMQ
EQAKLLKDQIKSGNITQYGIVTSTTSSGGTPSSTGGSYSGKYSSYINSAASKYNVDPALI
AAVIQQESGFNAKARSGVGAMGLMQLMPATAKSLGVNNAYDPYQNVMGGTKYLAQQLEKF
GGNVEKALAAYNAGPGNVIKYGGIPPFKETQNYVKKIMANYSKSLSSATSSIASYYTNNS
AFRVSSKYGQQESGLRSSPHKGTDFAAKAGTAIKSLQSGKVQIAGYSKTAGNWVVIKQDD
GTVAKYMHMLNTPSVKAGQSVKAGQTIGKVGSTGNSTGNHLHLQIEQNGKTIDPEKYMQG
IGTSISDASQAEAERQQGIAQAKSDLLSLQGDISSVNDQIQELQYELVQSKLDEFDKRIG
DFDVRIAKDESMANRYTSDSKEFRKYTSDQKKAVAEQAKIQQQKVNWIQKEIKTNKALNS
AQRAQLQEELKQAKLDLISVQDQVRELQKQLVQSKVDETLKSIEKSSSKTQGKIKDVDNK
ISMTEEDEDKVKYYSKQIKLIQQQQKEAKKYIKQLEEQKKAAKGFPDIQEQITEEIENWK
DKQKDFNLELYNTKKSIKDIYKSLADEVVSIYKEMYEKMRDIELEAHQKATQDLIDEIDK
TDDEAKFQKELKERQDSIQKLTDQINQYSLDDSEFGKSKVKELTEQLQKEQLDLDDFLKD
RESNKRKEALQDQLEKDEESINNKYDNLVNDERAFKKLEDKIMNGKITDIAKQLNEFSKF
INTNMESIGKSISNNLIDKLKEASNALNTAVKGNTTGKKVSSFASGGYTGTGLGAGKLAF
LHDKELILNKTDTANILDTVKAVRETAVDDSPKWGQGVKLADLIKKGITSIPSLVPNVNQ
SMLTNSLIPNLKKIEIPSKTIASSGDKTINLTNTFHIDKLIGGESGARSMFESIKNEVVK
LNGSM
Download sequence
Identical sequences A0A162SC87 O31976
224308.BSU21350 gi|255767473|ref|NP_390018.2| NP_390018.2.22788 WP_004398858.1.11257 WP_004398858.1.1140 WP_004398858.1.15902 WP_004398858.1.16291 WP_004398858.1.2914 WP_004398858.1.32420 WP_004398858.1.33846 WP_004398858.1.36189 WP_004398858.1.40859 WP_004398858.1.44184 WP_004398858.1.45019 WP_004398858.1.47157 WP_004398858.1.56274 WP_004398858.1.56411 WP_004398858.1.57201 WP_004398858.1.5726 WP_004398858.1.57513 WP_004398858.1.6517 WP_004398858.1.65223 WP_004398858.1.72999 WP_004398858.1.76977 WP_004398858.1.81116 WP_004398858.1.81747 WP_004398858.1.91723 WP_004398858.1.93420 WP_004398858.1.94199 WP_004398858.1.96043 WP_004398858.1.979 gi|402776392|ref|YP_006630336.1| gi|470162336|ref|YP_007534111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]