SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767716|ref|NP_391027.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767716|ref|NP_391027.2|
Domain Number 1 Region: 221-243,270-624
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.35e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.0000393
Further Details:      
 
Domain Number 2 Region: 54-264
Classification Level Classification E-value
Superfamily Lysozyme-like 3.09e-70
Family PBP transglycosylase domain-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255767716|ref|NP_391027.2|
Sequence length 624
Comment penicillin-binding protein 4 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MTMLRKIIGWILLLCIIPLFAFTVIASGKEVKQMKSLDQVLDKNIDLKDISLVQNSYMYD
RDGSLVSEIVSDHENRVLVPFNKIPEEVKQIFLTSEDRHFYEHKGFDFMGMVRATASNVK
DKKIDQGASTITQQLSRNLYLSHERSFSRKLTELAYSYQLEKKYTKNEILEAYLNTIYFN
NGVYGVGSAAQFYFSKPLKSLTVGEMAFICAIPNNPTLYDPLKHFDYTKSRQERLLKGLK
DAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGK
QKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTH
QIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKD
YCPQNYNNRTYGTVTLDTAFKNSYNTPAIRMLDRVGIQKAFSYIEPYHFAKLVDSDYLLP
AALGGFTNGMTPLEMTKAYTTFGNSGSYTPSHAITKVTDLKGKTLYKWNDKATQIFSVRT
NMQLKKLMSSVVKSGTGKKAYFNAPYIGGKTGTSNDYHDMWFVGLTDTYTMGVWVGKDTP
TSVEYLHSISPQLSIWKGTLQAAY
Download sequence
Identical sequences P40750 U1Z708
gi|470163364|ref|YP_007535139.1| 224308.BSU31490 gi|402777307|ref|YP_006631251.1| NP_391027.2.22788 WP_010886602.1.100042 WP_010886602.1.11231 WP_010886602.1.11257 WP_010886602.1.1140 WP_010886602.1.12759 WP_010886602.1.15902 WP_010886602.1.16291 WP_010886602.1.19261 WP_010886602.1.21045 WP_010886602.1.27372 WP_010886602.1.27660 WP_010886602.1.2914 WP_010886602.1.31100 WP_010886602.1.32219 WP_010886602.1.32420 WP_010886602.1.33846 WP_010886602.1.36189 WP_010886602.1.39562 WP_010886602.1.39605 WP_010886602.1.40859 WP_010886602.1.42762 WP_010886602.1.44140 WP_010886602.1.44184 WP_010886602.1.45019 WP_010886602.1.47157 WP_010886602.1.5262 WP_010886602.1.54596 WP_010886602.1.56274 WP_010886602.1.56411 WP_010886602.1.57201 WP_010886602.1.5726 WP_010886602.1.57513 WP_010886602.1.6139 WP_010886602.1.6517 WP_010886602.1.65223 WP_010886602.1.72516 WP_010886602.1.72999 WP_010886602.1.74782 WP_010886602.1.76977 WP_010886602.1.78686 WP_010886602.1.79046 WP_010886602.1.81116 WP_010886602.1.81747 WP_010886602.1.82722 WP_010886602.1.84556 WP_010886602.1.88042 WP_010886602.1.88591 WP_010886602.1.91060 WP_010886602.1.91723 WP_010886602.1.93073 WP_010886602.1.93420 WP_010886602.1.94199 WP_010886602.1.95009 WP_010886602.1.96043 WP_010886602.1.97264 WP_010886602.1.979 WP_010886602.1.99399 gi|255767716|ref|NP_391027.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]