SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255767792|ref|NP_391631.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767792|ref|NP_391631.2|
Domain Number 1 Region: 219-241,271-660
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.45e-111
Family beta-Lactamase/D-ala carboxypeptidase 0.0000925
Further Details:      
 
Domain Number 2 Region: 50-263
Classification Level Classification E-value
Superfamily Lysozyme-like 2.64e-75
Family PBP transglycosylase domain-like 0.00000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255767792|ref|NP_391631.2|
Sequence length 691
Comment penicillin-binding protein 2D [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MDAMTNKRLRLTLKTVRAFIFLGAFAALAAAAVFMTVILIAKYQGAPSVQVPQSTILYAS
DGSKLGETNYGEKRYWVPLKDMNPTIVKATVAIEDQNFYDHHGFDYKRMAGAALADLKAF
AKVQGASTITQQYARNLYLEHDKTWKRKWNEAFYTIRLEQNYSKDEILEGYLNTIYYGHG
AYGIEAASRLYFGKHAKNLTDAEAALLAGIPKGPSGYSPYVNETKAKERQKTIVRMMEKQ
QMISQKKADELIKEPLSYQPLNKQVSKRKAPYFYDNAMRELEKKLGMTREQIETSGLNVY
TTVDKRMQRIAEETITETVNAGSDIQVGFSAIDPRTGNVLALVGGRDYQKSPFDRTTQAK
RQPASTIKPLLYYKAIQSGFTPVTLMKSEETEFQIDAKGETYSPSNYNGYYANKPITLLQ
ALALSDNIYAVKTHLFLGTNKLVKTAKEFGITAHLQALPSLALGTEPVRPIEMVNAYAML
ANGGKKIEPTFISRVTDAAGHVLYENPNQHKQVLDEKAAFVTASMMTGMFDIDLNGYTSV
TGRTIANRLTRTYAGKSGTTSADSWMIGFNPKLAAGVWTGYDKNSTIDSVEEKSYAKTIW
ADFMEDALKGEPETAFKPPKGVTGVYIDPETGYSSGPGCAAKHYTYFVKGTEPANVCYGA
EPAKQTKDRLPSKEKPASEKKWWDKWLGRHH
Download sequence
Identical sequences A0A162RC11 A0A1B2B7U1 G4EQ17 L8ASS6 P70997
NP_391631.2.22788 WP_003227540.1.11257 WP_003227540.1.1140 WP_003227540.1.12759 WP_003227540.1.15902 WP_003227540.1.16291 WP_003227540.1.19261 WP_003227540.1.27372 WP_003227540.1.32219 WP_003227540.1.32420 WP_003227540.1.33846 WP_003227540.1.36189 WP_003227540.1.39605 WP_003227540.1.40859 WP_003227540.1.44140 WP_003227540.1.44184 WP_003227540.1.45019 WP_003227540.1.47157 WP_003227540.1.56274 WP_003227540.1.56411 WP_003227540.1.57184 WP_003227540.1.57201 WP_003227540.1.5726 WP_003227540.1.6139 WP_003227540.1.65223 WP_003227540.1.72999 WP_003227540.1.76977 WP_003227540.1.78686 WP_003227540.1.78811 WP_003227540.1.79712 WP_003227540.1.81116 WP_003227540.1.81747 WP_003227540.1.82722 WP_003227540.1.88042 WP_003227540.1.91723 WP_003227540.1.94199 WP_003227540.1.96043 WP_003227540.1.979 gi|560130778|ref|YP_008831919.1| 224308.BSU37510 gi|470163972|ref|YP_007535747.1| gi|255767792|ref|NP_391631.2| gi|402777914|ref|YP_006631858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]