SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16078175|ref|NP_388992.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078175|ref|NP_388992.1|
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.35e-90
Family DegV-like 0.000000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16078175|ref|NP_388992.1|
Sequence length 283
Comment Degv domain-containing protein YitS [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MTVHLIADSATDLPRSYFEEKGIGFIPLRVSLGDKEFEDAVTIHADQIFEAMQNGETPKT
SQASPQTIKNVFLQYAETGDPALYIAFSSGLSGTYQTAVMIANEVKEEFPDFDLRVIDSK
CASLGYGLAVRHAADLCINGNTIQEIETSVKNFCSQLEHIFTVDDLTYLARGGRISKTSA
FVGGLLNIKPLLQMEDGKLVPLEKIRGQKKLFKRIIELMKERGDDWSNQTVGISYAANKE
KATDMKHLIEEAFKPKEIIMHPISSAIGSHAGPGTLAIFFLRK
Download sequence
Identical sequences A0A0T8PP94 A0A125UG47 A0A1D8FIU6 L8ABQ2 P70945
gi|16078175|ref|NP_388992.1| gi|560128154|ref|YP_008829295.1| NP_388992.1.22788 WP_003245785.1.101301 WP_003245785.1.11231 WP_003245785.1.11257 WP_003245785.1.1140 WP_003245785.1.11581 WP_003245785.1.12759 WP_003245785.1.15902 WP_003245785.1.16291 WP_003245785.1.18944 WP_003245785.1.19261 WP_003245785.1.20099 WP_003245785.1.2546 WP_003245785.1.25531 WP_003245785.1.27372 WP_003245785.1.27660 WP_003245785.1.2914 WP_003245785.1.31100 WP_003245785.1.32219 WP_003245785.1.32420 WP_003245785.1.32861 WP_003245785.1.33846 WP_003245785.1.36189 WP_003245785.1.37074 WP_003245785.1.39605 WP_003245785.1.44140 WP_003245785.1.44184 WP_003245785.1.45019 WP_003245785.1.47157 WP_003245785.1.56274 WP_003245785.1.56411 WP_003245785.1.57184 WP_003245785.1.5726 WP_003245785.1.57513 WP_003245785.1.6139 WP_003245785.1.6517 WP_003245785.1.65188 WP_003245785.1.65223 WP_003245785.1.65841 WP_003245785.1.72516 WP_003245785.1.72999 WP_003245785.1.78686 WP_003245785.1.78811 WP_003245785.1.79712 WP_003245785.1.79987 WP_003245785.1.80832 WP_003245785.1.81116 WP_003245785.1.81747 WP_003245785.1.82722 WP_003245785.1.84183 WP_003245785.1.88042 WP_003245785.1.91723 WP_003245785.1.93073 WP_003245785.1.93420 WP_003245785.1.94199 WP_003245785.1.96043 WP_003245785.1.979 APC1201 224308.BSU11110 gi|470161270|ref|YP_007533045.1| gi|321314838|ref|YP_004207125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]