SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347419|ref|NP_810922.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347419|ref|NP_810922.1|
Domain Number 1 Region: 15-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-57
Family Nucleotide and nucleoside kinases 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29347419|ref|NP_810922.1|
Sequence length 204
Comment guanylate kinase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MSTFSVFNFQFSIKQMTGKLIIFSAPSGSGKSTIINYLLTQNLNLAFSISATSRPPRGTE
KHGVEYFFLTPEEFRCRIENNEFLEYEEVYKDRYYGTLKEQVEKQLEKGQNVVFDLDVVG
GCNIKKYYGERALSIFVQPPSIEELRCRLTGRGTDEPEVIECRIAKAEYEMTFAPQFDRV
IVNDDLEAAKAETLEVIKEFLNKE
Download sequence
Identical sequences A0A173VC97 Q8A677
226186.BT_2009 gi|29347419|ref|NP_810922.1| NP_810922.1.73244 WP_011108086.1.29471 WP_011108086.1.81417 WP_011108086.1.83447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]