SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29350088|ref|NP_813591.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29350088|ref|NP_813591.1|
Domain Number 1 Region: 300-525
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.76e-38
Family ABC transporter ATPase domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 40-296
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.23e-18
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 758-830
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000615
Family Smr domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|29350088|ref|NP_813591.1|
Domain Number - Region: 451-473,547-660
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.011
Family C-terminal domain of PLC-beta 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29350088|ref|NP_813591.1|
Sequence length 833
Comment DNA mismatch repair protein MutS [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MIYPQNFEQKIGFDQIRQLLKDKCLSTLGEERVSDMSFTEQFEEVEEKLNQVTEFVRIIQ
EEDGFPDQFFFDVRPSLKRVRIEGMYLDEQELFDLRRSLETIRDIVRFLHRNEEEEENDV
PYPSLKRLAGDIAVFPQLIGKIDGILNKYGKIKDNASSELARIRRELSSTMGSISRSLNS
ILRNAQSEGYVDKDVAPTMRDGRLVIPVAPGLKRKIKGIVHDESASGKTVFIEPAEVVEA
NNRIRELEGDERREIIRILTEFSNILRPSIPDILQSYEFLAEIDFIRAKSYFAIQTNSLK
PTVEKEQLLDWTMAVHPLLQLSLAKHGKKVVPLDIELNQKQRILIISGPNAGGKSVCLKT
VGLLQYMLQCGMLIPLHERSHAGMFSSIFIDIGDEQSIEDDLSTYSSHLTNMKIMMKSCN
ERSLILIDEFGGGTEPQIGGAIAEAVLKRFNQKGTFGVITTHYQNLKHFAEDHEGVVNGA
MLYDRHLMQALFQLQIGNPGSSFAVEIARKIGLPEDVIADASEIVGSEYINADKYLQDIV
RDKRYWEGKRQTIRQREKHMEDTIARYQTEMEELQKSRKEIIRQAKEEAERMLQESNARI
ENTIRTIKEAQAEKEKTRLVRQELNDFRTSLETMTSKEQEEKIARKMEKLKEKQERKKNK
KNEPKTAASQTAATPKVIPITVGENVKIKGQTSVGQVMEINGKNATVAFGSIKTTVKLDR
LERSNAAPKTEGIAKSTFVSSQTHDQMYEKKLNFKQDIDVRGMRGDEALQAITYFVDDAI
LVGMDRVRILHGTGTGILRTLIRQYLSTVPGVSHYADEHVQFGGAGITVVDFD
Download sequence
Identical sequences Q89YQ1
gi|29350088|ref|NP_813591.1| NP_813591.1.73244 226186.BT_4680 APC82244 BtR189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]