SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29346352|ref|NP_809855.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29346352|ref|NP_809855.1|
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 8.37e-58
Family ADP-ribosylglycohydrolase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29346352|ref|NP_809855.1|
Sequence length 262
Comment dinitrogenase reductase activating glycohydrolase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MNTDILIGAIAGDIIGSYYEFVPIKSIDFPLFNGSSSHFTDDTIMTIANADWLLTGDSLL
GIMQDYGNRYHSSYGSMFYEWLRADNPQPYNSWGNGSAMRVSPIDWAFNTLEETLEAAKQ
SAEVTHNHPEGIKGAQATAACIYLARTGKSKQEIKEYVETTFGYNLNRTCDDIRPTYHFN
ESCQGTIPESIIAFLESTDYESAIRLTISLGGDADTMGAITGGIAEAYYKEIPQYIIDEV
LKRLSEEFIDIMQRFYRMFISS
Download sequence
Identical sequences A0A221JFM8 A5ZK57 Q8A975
APC81416 gi|29346352|ref|NP_809855.1| 226186.BT_0942 NP_809855.1.73244 WP_005679031.1.59392 WP_005679031.1.70665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]