SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000063 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000063
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-105
Family Thrombospondin C-terminal domain 0.0000000833
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.44e-34
Family TSP type-3 repeat 0.00000357
Further Details:      
 
Domain Number 3 Region: 515-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.01e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 446-539
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000122
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 309-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000703
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 52-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000467
Family Laminin G-like module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000063
Domain Number - Region: 416-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00568
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 368-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 275-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0591
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000063   Gene: ENSBTAG00000000057   Transcript: ENSBTAT00000000063
Sequence length 956
Comment pep:known chromosome:UMD3.1:3:15470302:15480443:1 gene:ENSBTAG00000000057 transcript:ENSBTAT00000000063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCTFVSASQDLQVIDLLTVGESRQMIAVVEKIRTALLTTGDIYLLS
TFRLPPKQGGVLFGLYSRHDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSKPSPALQLYVDCKLGDQHAGLPALAPIPPAEVNGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFVGNQSQGCFPARTCHS
PAHSPCHAHAHCLFERNGAVSCACNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDACDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGDGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGNTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences F1MHQ8 L8ICS4
9913.ENSBTAP00000000063 ENSBTAP00000000063 ENSBTAP00000000063 XP_005898743.1.15283 XP_010836597.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]