SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000073 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000073
Domain Number 1 Region: 47-325
Classification Level Classification E-value
Superfamily L domain-like 8.84e-43
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 585-681
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000503
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000073   Gene: ENSBTAG00000000066   Transcript: ENSBTAT00000000073
Sequence length 728
Comment pep:known_by_projection chromosome:UMD3.1:13:48578735:48593922:-1 gene:ENSBTAG00000000066 transcript:ENSBTAT00000000073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWALLLLLPFAIAPRPSQAGPLQNSLVFRLTQQGPWGSGAGNSTVSPCEWLPVAGVTTL
TFVNRGLERLPGCLPRALRSLDGSHNLLRALSAPELGHLPQLQVLTLRHNRITALGWGPG
APAGLHSLDLSYNLLATLPPCTGPALPGLRALALAGNPLRTLQPGAFACFPELRLLNLSY
TKLGRGDHEDIADATFAGVGGAPLAALQVLDLSGTFLPRVRSGWIRNLPRLTSLYLRKMP
RLRSLEGDIFKMTPDLQHLDCQHSPALSSVHTYIFQDTPHLRVLHFQNCNLSSFHPWNLH
SSQVLSINLFGNPLTCSCELSWLLMDAKRIVLSRAADIVCKPAAGSSGTFSAPLLLSQLP
SVCHSDQNTTLLDSNPPSSVISTHTPSAQGSSTLRSTTPSTTPAGGQQSVTRFPSLPVDS
PTRAARLRYSLAKDGATPSTTVSPTGSSNSGDPPKSVSTAWAEHQEYATGLILEPSSSAA
SIPWASRHPGLSPASRDSVSLPQPAWETRATLQSPHPPPSEGGIPVLLQDDSREEEEEES
GKEEVGAPAWDVPCDYHPCRHLQTPCAELQRRWRCRCPGLSGEDTLPEPPKLQAVAETTD
TTALVRWCAPNSVVRAYQIRYAPEAPGNQSVVGDVCATARQHALHGLLPATAYRVCVLAA
NGAGLSQRGACAAFTTGRSPVFITAGLGSAGGLLLVSTALLATGLCRRGRTPRTPPCHTQ
LLAYRNPA
Download sequence
Identical sequences E1BCJ9
ENSBTAP00000000073 ENSBTAP00000000073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]