SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000135 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000135
Domain Number 1 Region: 44-198
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.1e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 203-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.67e-36
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000135   Gene: ENSBTAG00000000124   Transcript: ENSBTAT00000000135
Sequence length 414
Comment pep:known chromosome:UMD3.1:5:30894556:30899509:1 gene:ENSBTAG00000000124 transcript:ENSBTAT00000000135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAASMALPASLVPLCCLALLALPAQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSVPERT
LGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMN
MWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESRNHVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVP
TPVLLFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRA
GDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRA
FAPLRLLHALGALLPGGAVQPTGMHWYSRFLYRLGGWVLDGDLPPDWGRVSPAQ
Download sequence
Identical sequences F1MFP2
ENSBTAP00000000135 ENSBTAP00000000135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]