SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000176 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000176
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 1.07e-44
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 427-504
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000168
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000176   Gene: ENSBTAG00000000153   Transcript: ENSBTAT00000000176
Sequence length 628
Comment pep:known chromosome:UMD3.1:18:46818878:46825746:1 gene:ENSBTAG00000000153 transcript:ENSBTAT00000000176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLPLLLCLLPLAPASSPPQPASPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIATVRRRDLANMTGLLHLSLSRNTIRHVAAGAFSDLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPGD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGEPDALTPPSAASASASA
KAAEAGPPTDRGVQVTEHGATAALIQWPDQRPIPGIRMYQIQYNSSADDILVYRMIPAES
SSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCNRFSTEPALRPCGAPHAPFLGGT
MIIALGGVIVASVLVFIFVLLMRYKVHGGQPPGKTKASAPVSSVCSQTNGALGPMPAPPA
PEPSAPRAHTVVQLDCEPWGPSHEPMGP
Download sequence
Identical sequences Q1RMS4
ENSBTAP00000000176 NP_001070427.1.59421 NP_001070427.1.76553 XP_005219090.1.76553 9913.ENSBTAP00000000176 ENSBTAP00000000176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]