SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000263 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000263
Domain Number 1 Region: 455-560,682-798
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.21e-56
Family Phosphate binding protein-like 0.0000000402
Further Details:      
 
Domain Number 2 Region: 72-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.45e-26
Family L-arabinose binding protein-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000263   Gene: ENSBTAG00000000219   Transcript: ENSBTAT00000000263
Sequence length 1497
Comment pep:known_by_projection chromosome:UMD3.1:5:96408804:96761516:1 gene:ENSBTAG00000000219 transcript:ENSBTAT00000000263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLVSVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQPRALGK
KPLDIGLPSSKHSQLGDLYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKDGLRDFYLDQFRAK
ETSPHWEHVDLTDLYKERGEDFKRDSVGGGGPCTNRAHHLKHGTGDKHGGGVVGGVPAPW
EKNLTNVDWEERPGGNFCRSCPSKLHNYSTTTAATAVVAGQNSGRPACIRCEACKKAGNL
YDISEDNSLQELDQPAAPVAAVTSAASKYPQSPTNSKAQKKPRNKLRRQHSYDTFVDLQK
EEAALAPRSVSLKDKGRFLDGSPYAHMFEMPAGESAFSGSNDGKAAAPAAGHHHHGNPGG
GGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGAPKARPDFRALVSN
KPVVSALHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences F1MCL3
ENSBTAP00000000263 NP_001179850.1.59421 NP_001179850.1.76553 XP_005207045.1.76553 XP_012006280.1.54773 XP_019817084.1.53367 ENSBTAP00000000263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]