SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000458 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000458
Domain Number 1 Region: 279-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-36
Family SPRY domain 0.00036
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 7.95e-19
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000118
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000458   Gene: ENSBTAG00000038209   Transcript: ENSBTAT00000000458
Sequence length 448
Comment pep:novel chromosome:UMD3.1:29:5748317:5757809:1 gene:ENSBTAG00000038209 transcript:ENSBTAT00000000458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLQVFQSELTCSICMNCFLDPVTIDCGHSFCRPCLSLCWEEGQTPRRCPECRGISE
RPDFKTNIALKRLASLARQARADHDHSSEEQICVTHQEAKGLFCEADQTLLCGPCSECPE
HAAHSHSPIHRAAEESREKLLKRMSSLWKMREEIQICLNQEANTTQSFEDYVALRKVMIK
LEYQRMLLLLREEEQLHLEALEREAKEICEELKESVFRMSQYRESLKEMYKELTEMCHKP
DMELLQGLENVLETTHLTQIQKPQPVNPELPSWPVSGFLHMLNNFRVDNVLSLTTIVHHA
ILDDESALFEDDHPIASRQPQGRSCIVSWGAWGFTSGRHYWELDVAQSSSWVLGVCKSIF
TSDTSISIGAEEAYFLCSTKVNSQYILSTTSPPLVQFVKRPLGKIGVFLDYDNGTVSFYD
VFRSSLIYSFLPSAFSSPMIPFLCLKSP
Download sequence
Identical sequences G3X679
XP_005200275.1.59421 XP_010799115.1.76553 ENSBTAP00000000458 ENSBTAP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]