SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000533 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000533
Domain Number 1 Region: 106-403
Classification Level Classification E-value
Superfamily L domain-like 2.49e-64
Family Internalin LRR domain 0.048
Further Details:      
 
Domain Number 2 Region: 1367-1457
Classification Level Classification E-value
Superfamily PDZ domain-like 4.39e-21
Family PDZ domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 24-132
Classification Level Classification E-value
Superfamily L domain-like 3.83e-19
Family Ngr ectodomain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000533   Gene: ENSBTAG00000000415   Transcript: ENSBTAT00000000533
Sequence length 1460
Comment pep:known_by_projection chromosome:UMD3.1:20:13483520:13558286:-1 gene:ENSBTAG00000000415 transcript:ENSBTAT00000000533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTALPASIANLINLRELDVSKNGIQEFPENIKNCKVLTVV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNRLTFIPGFIGSLKQLTYLDISKN
NIEMVEEGISGCENLQDLLLSSNSLQQLPETIGSLKNVTTLKIDENQLMYLPDSIGGLVS
IEELDCSFNELEALPSSIGQLTNIRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETL
PEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL
KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGKDLKPHEDQQVVNNDVGVKTSESIT
PVRSKADEREKYMIGNSIQKTSEPEAEVSSGNLPVTANVKASENLKHIVNHDDVFEESEE
LSSDEEMKMAEMRPPLIETSINQPKVVALSSNKKDDTKDTDSLSDEVTHNSNQNNSNCSS
PSRMSDSVSLNTDSSQDTSLCSPVKQTHIGINSKIRQEDENFNSLLQNGDILNHSTEEKI
KVPDKKDFNLPEYDLNIEERLVLIEKGVDSTATSDESHKLDHINMNLNKLVTNDTFQPEI
VERSKTQDTALGMGFLSNNAKGEAEHLENGNKFPNVECINKVNGHSEETPQSPRRTEPHD
TDSSVDVGHSKSTEDLSPQKSGPIGPVVKSHSITNMETGGLKIYDILSDNGPQQPSATAK
VTSTIDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGAKAIFKFDSNHNPEEPHIRGP
TTSGPQSVPQMYGPPQYNIQYSGSAAVKDTLWHSKQNPQVDPVSFPSQRFPRSESTESHS
YAKHSANMNFSNHNNVRANTGYHLHQRLGPGRHGDMWAISPNDRLIPGATRTTIQRQSSV
SSAASVNLGEPGSTRRTQVPEGDYLSYRELHSVGRTPPMMSGSQRPLSARTYSVDGPHAS
RPQSARPSVSEIPERTMSVSDFSYSRTSPSKRPNTRVGSEHSLLDPPGKSKVPHDWREQV
LRHIEAKKLEKSMLSRSFNSNFTAVSNFHYGSSRDLHGSQGSLALSVADGRGSGGHTFRH
PQTSCPGDPCQDDIFISGQQNYPSATLSHKDVLPDSLMKMPLSNGQMGQPLRPQANYSQI
HHPLPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELARQEIRVRVEKDPEL
GFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAV
SLLKTFQNTVELIILREVSS
Download sequence
Identical sequences E1BKT3
ENSBTAP00000000533 XP_005221508.1.76553 ENSBTAP00000000533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]