SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000604 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000604
Domain Number 1 Region: 241-596
Classification Level Classification E-value
Superfamily L domain-like 3.91e-36
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 685-835
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-35
Family Toll/Interleukin receptor TIR domain 0.00025
Further Details:      
 
Domain Number 3 Region: 31-240
Classification Level Classification E-value
Superfamily L domain-like 1.02e-27
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000604   Gene: ENSBTAG00000000477   Transcript: ENSBTAT00000000604
Sequence length 858
Comment pep:known chromosome:UMD3.1:16:27303741:27306317:-1 gene:ENSBTAG00000000477 transcript:ENSBTAT00000000604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDCLDLLLGVVLLTSPALGMSSCFFDGWRAIYLSCNLTQVPQVPNTTKSLLLSFNYIRT
VTTASFPFLEQLQLLELGTQFTPLTIYREAFRNLPNLRILDLGGSQINFLHPDAFQGLPH
LTKLRLFSCGLSDAVLKDGYFRNLASLTHLDLSKNKIQSLYLHPSFRELNSLKSIDFSFN
KIPIVCEQEFKPLQGKTLSFLSLADNQLYSRVSVDWNKCLNPFRNMVLETLDVSGNGWGV
DIMRNFSNAINGSQIFSLVLTRHIMGSSFGFSNLKDPDYHTFAGLARSSMIQLDISHGYI
FSLNFRIFETLQELKVLNLAYNKINSISRNAFYGLDNLQVLNISYNLLGELYNYDFDGLP
KVAYIDLQKNHIGIIQDKTFKFLGKLNTLDLRDNALKTIYFLPSIPNIFLSGNKLMTLPN
IPLTANFIQLSENRLENLNDLYFLLQVPHLQILILNQNRFSFCHQNHAPSENSSLEKLFL
GENMLQLAWETGSCWDIFKGLSHLQLLYLNKNYLNFLPPGVFHHLTALRGLSLKDNRLTV
LFPGDLPANLEILDISGNQLLSPDPDLFASLSAIDITHNNFICECELSAFIHWLNQTNIT
IAGSPADMYCMYPNSLAGVSIYSLSTESCEEEEVLESLKFSLFILVTVTLTLFLVITLAV
TKFRGFCFICYKKAQSLLFKDPIKGRESDTYKYDAYLCFSSKDFEWVQNALLKHLDVQYH
SQNRFNLCFEERDFMPGENHIANIQDAVWSSRKIVCLVSRHFLRDGWCLEAFSYAQSRCL
ADLNGALIMVVVGSLSQFHLMRHQSIRGFVQKRQYLRWPEDLQDVDWFLNKLSQCILKKE
KERKKDSAIQLQNVTTIS
Download sequence
Identical sequences A7YK54 D0EP63 Q2LDA0
ENSBTAP00000000604 XP_015322242.1.59421 XP_015322243.1.59421 XP_015322244.1.59421 XP_015322245.1.59421 XP_015330544.1.76553 XP_015330545.1.76553 XP_015330546.1.76553 XP_015330547.1.76553 ENSBTAP00000000604 9913.ENSBTAP00000000604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]