SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000612 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000612
Domain Number 1 Region: 35-360
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-120
Family Bee venom hyaluronidase 0.00000788
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000612
Domain Number - Region: 425-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000612   Gene: ENSBTAG00000000484   Transcript: ENSBTAT00000000612
Sequence length 473
Comment pep:known chromosome:UMD3.1:22:50592324:50597462:1 gene:ENSBTAG00000000484 transcript:ENSBTAT00000000612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGRSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRHLVAIRHPDWPPERVAKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LAWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQMHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFT
Download sequence
Identical sequences L8ISE7 Q8SQG8
9913.ENSBTAP00000051198 ENSBTAP00000000612 NP_776772.1.59421 NP_776772.1.76553 XP_005892181.2.15283 XP_010815967.1.76553 XP_010815968.1.76553 XP_014332582.1.15283 XP_014332583.1.15283 XP_019839956.1.53367 XP_019839957.1.53367 ENSBTAP00000000612 ENSBTAP00000051198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]