SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000700 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000700
Domain Number 1 Region: 13-280
Classification Level Classification E-value
Superfamily L domain-like 2.83e-39
Family Polygalacturonase inhibiting protein PGIP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000700   Gene: ENSBTAG00000000539   Transcript: ENSBTAT00000000700
Sequence length 367
Comment pep:known_by_projection chromosome:UMD3.1:21:7411027:7600816:-1 gene:ENSBTAG00000000539 transcript:ENSBTAT00000000700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASELCKTISVARLEKHKNLFLNYRNLQHFPLELLKDEGLQYLERLYMKRNSLTTLPENL
AQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLAN
NQLQFLPPEVGDLKELQTLDISTNRLLTLPERLHLCLSLQYLTVDRNRLWCVPRHLCQLP
SLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSFLYNKVIGCSGCGAPIQVS
EVKLLSFSSGQLTVFLPAEVKAIGTEKDHILPLQELAMRTLHHTYHASLKDLDFLSPVSL
PRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQGRTTVSFVAYCCSTQCL
QTFDLLS
Download sequence
Identical sequences F1MS73 L8IYN3
ENSBTAP00000000700 9913.ENSBTAP00000000700 XP_005888457.1.15283 XP_010844136.1.44457 XP_019839312.1.53367 ENSBTAP00000000700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]