SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000731 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000731
Domain Number 1 Region: 16-628
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 5.1e-229
Family Aconitase iron-sulfur domain 2.29e-16
Further Details:      
 
Domain Number 2 Region: 633-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.96e-83
Family LeuD-like 0.000000000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000731   Gene: ENSBTAG00000000555   Transcript: ENSBTAT00000000731
Sequence length 889
Comment pep:known_by_projection chromosome:UMD3.1:8:11480118:11543046:-1 gene:ENSBTAG00000000555 transcript:ENSBTAT00000000731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFAHLVEPLDPAQPGKKFFNLNKLEDSRYGSLPFSIRVLLEAAIRNCDQFLVKKNDV
ENILNWKVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPA
DLVIDHSIQVDFNRRADSLKKNQDLEFERNKERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIKYLVQTGRDKEKVKHIKQYLQVVGMFRDFSDSSQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNNS
KFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEAVVEAIVQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAAPSDKLYCWNPKSTYIKSPPFFEDLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSR
DWAAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIP
ETLKPRMKVQIKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMTK
Download sequence
Identical sequences F1MS05
ENSBTAP00000000731 ENSBTAP00000000731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]