SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000753 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000753
Domain Number 1 Region: 1516-1739
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.76e-80
Family Fibrinogen C-terminal domain-like 0.00000195
Further Details:      
 
Domain Number 2 Region: 1346-1508
Classification Level Classification E-value
Superfamily Fibronectin type III 6.87e-23
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 3 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-21
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 1253-1342
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-17
Family Fibronectin type III 0.0000284
Further Details:      
 
Domain Number 5 Region: 714-883
Classification Level Classification E-value
Superfamily Fibronectin type III 5.89e-17
Family Fibronectin type III 0.0000171
Further Details:      
 
Domain Number 6 Region: 624-710
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-16
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 7 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000361
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 8 Region: 1076-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000001
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000753
Domain Number - Region: 412-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00471
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00691
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00785
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0115
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000753   Gene: ENSBTAG00000000575   Transcript: ENSBTAT00000000753
Sequence length 1746
Comment pep:known_by_projection chromosome:UMD3.1:8:105965498:106067887:-1 gene:ENSBTAG00000000575 transcript:ENSBTAT00000000753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVMTRLWAGLFLALLALPAEGGVLKKVIRHKQQSGMNVTLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAAPSEPRESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTSGAGCCLQSAEGRVDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLHGQCLDGQCVCHEGFTGEDCGQLACPSDCNDQGKCVDGACVCFE
GYSGLDCSQETCPVPCSEEHGRCVDGRCVCQEGFAGEDCREPLCLHNCHGRGRCVENECV
CDEGFTGDDCGELVCPNDCFDRGRCLNGTCSCDEGFTGEDCGQLACPHACHGHGRCDEGQ
CVCDEGFAGPDCSERRCPSDCHERGRCVDGRCECNDGFTGADCGELQCPRDCSGHGRCVN
GQCVCDEGYTGEDCGQRRCPSDCHGRGRCVDGRCECQPGFQGDDCGEMSCPHDCHQHGRC
VNGMCVCDDAYTGEDCRELRCPGDCSQRGRCVDGRCVCEDGFAGPDCADLACPGNCHGRG
RCVDGQCVCLEGFTGPDCAQRRCPGDCHGQGRCVDGQCVCHEGFTGPDCAQRSCPNDCSN
WGQCVSGRCVCNEGYTGEDCSQVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLIVYTPTH
EDGLEMQFRVPGDQTSATIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPTPEGLKF
KSIKETSVEVEWDPLDIAFETWEVIFRNMNKDDEEEITKSLRRPETTYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWSKPLAEIDSIELMYGIK
DVPGDRTSIDLTHEENQYSIGNLKPDTEYEVALISRRADMSSNPAKETFTTGLDAPRNLR
RISQTDNSITLEWRNVKAAADSYRIKYAPISGGDHAEVEVPRSQQTTTRTTLTGLRPGTE
YGIGVSAVKGDKESDPATINAATELDTPKDLRISDPTETSLTLVWQTPVAKFDRYRLNYS
LPSGQPKEVQLTRDTTSFVLRGLEPGQEYSILLTAEKGRHKSKPARVQASTDHTPELGNL
TVTKAGWDGLRLNWTAADQAYEHFVIQVQEANGVEAAQNLTVPGNLRAVDVPGLKAATPY
RVTIHGVIRGYRTPVLSAEASTGDTPHLGEVTVSEVGWEALKLNWTAPEGVYEQFLIQVQ
EPGKEEAAQNLTVPGGLRSVDLPGLKAATHYSITIRGVTRDFSTAPHSVEALTAMGSPKE
IIFSDITENAASVSWMAPTTQVESFRVTYVPIAGGAPSAVTVDGTKTQTRLLRLLPGADY
LVSVIALKGFEESEPVSGTLTTALDGPSSLVTANITDSEALAMWQPAIAPVDNYVISYTG
ERVPEITRTVSGNTVEYALTNLEPATEYTLRIFAEKGPQKSSTITTKFTTDLDSPRDFTA
TEVQSETALLTWRPPRASVTGYLLVYESVDGTIKEVVLDPDTTSYSLTDLSPSTYYTARI
QALNGTLRSKTVKTIFTTSGVLYRFPRDCSQAMLNGDTTSGVYTIYLNNDKTQKQEVFCD
MTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDLKEEFWLGLDTLSKITAQGQYELRVD
LRDHGESAHAVYDKFSVGDARTRYRLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITN
CALSYKGAFWYKNCHRVNLMGRYGDNSHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLE
GRRKRA
Download sequence
Identical sequences F1MRZ5
ENSBTAP00000000753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]