SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000786
Domain Number 1 Region: 67-118
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000124
Family LEM domain 0.0032
Further Details:      
 
Domain Number 2 Region: 313-383,411-465
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000182
Family Ankyrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000786
Domain Number - Region: 222-257
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.068
Family N-terminal domain of RNase HI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000786   Gene: ENSBTAG00000033339   Transcript: ENSBTAT00000000786
Sequence length 967
Comment pep:known_by_projection chromosome:UMD3.1:17:45465976:45489004:1 gene:ENSBTAG00000033339 transcript:ENSBTAT00000000786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPRLAATEWAALAWELLGASVLLIAVRWLVRRLDRRPRGLGQSGPPDPPSRAVAGPAP
DSGKMTMDTILARLKLLNPDELREEIVKAGLKCGPITSTTRFIFEKKLAQALLERGTLPS
HLSDPGAADAPSLGQDTQRIVKSAVGSPAEQVSFSEDRDFGYSVGLNPPEEDAVTSKTCS
APFSASGGINSQKAVLRASAEVPLYYGVCPAAFEDTPARNERIHVYEDKKEALQAVKMNK
GSRFKAFTNREDAEKFARGSCDYFPSPSKTSLPLSPVKTAPLFSNGGLKDGLYLSESETA
SKERANSYKNPRTQDLTAKLRKAVEKGDEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYN
VMHVAAKENQAAVCQLTLETLENPEFMRLMYPDDEPHMLEKRICYVVDLYLNTPDRAGYD
TPLHFACKFGNVDVVNVLSSHPLIVKNPRNKYDKTPEDVICERSKNKSVELKERIRDYLK
GHYYVPLLRAEDTSSPVIGELWSSDQTGEVSHIGHTGGFPKDPVLTLRAFAGPLSPSKAE
DFRRLWKTPPREKAGFFHSVRKSDPERGIERVGRELAHELGYPWVEYWDFLGCFVDLSSQ
AGLQKLEEYLTQQEVGKKHLQDMGENAACRQEDASALGRQRKCSNSISVRAFLDEDDDMS
LEEIKNRQNTARNNTPPRAAAFGDLGCDILPLEQTELIEASAPTSPHSSRNGFCSPLRDG
KTLGGKRPKAQSGEEDLRSPISGLTVEFDKLNLQNLESSFSKTPNQRVKTRDKKVLTSRV
NAGGSDVLEPLAADRLGNNQGRTENEMSAGIANMCLNPDSSVHEPRYGNGSEPSEIPASK
EPVQRLFLFGEEPSKLDRDVLAALECTDVDPRQYPAVHRWRSAVLCYSPSDRQSWSSPSL
KGKLKSQLLDVSSPPSGSPGRSSPAGSSPGKPGSTPHASGLGSPGRYSPANGGHLRRMAR
LAQLATL
Download sequence
Identical sequences E1BFD1
ENSBTAP00000000786 9913.ENSBTAP00000000786 ENSBTAP00000000786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]