SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000793 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000793
Domain Number 1 Region: 31-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-38
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000793   Gene: ENSBTAG00000000601   Transcript: ENSBTAT00000000793
Sequence length 1736
Comment pep:known_by_projection chromosome:UMD3.1:23:7290455:7318840:-1 gene:ENSBTAG00000000601 transcript:ENSBTAT00000000793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCSRCHHLLLLVLLLLWLSAAPAWAGTAPVDVLRALRFPALPDGVRRARGICPADVAY
RVSRPAQLSAPTRQLFPGGFPKDFSLLTAVRARPGLQAPLLTLYSAQGVRQLGLELGRPV
RFLYEDQTGRPQPPAQPVFRGLSLADGKWHRVAVAVKGQSVTLIIDCKKRVTRPLPRSAR
PVLDTRGVIIFGARILDEEVFEGDIQELSIIPGVQAAYESCDQKELECEGGWRERPQRQP
SHRTQRSPKQQPPRLHRPQNQEPQAQSTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEE
GILESSPLPPPEEEQTDLQVPPTADRFLTEEYGEGGTEPPAGPYDYTYAYGDDYHEETEL
GPALSAETARSEAAARGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGFPGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSGGGDKGPVVAAQEAQAQAILQQ
ARMALRGPPGPMGYTGRPGPLGQPGSPGMKGESGDLGPQGPRGPQGLMGPPGKAGRRGRA
GADGARGMPGEPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGTQGLP
GPQGAIGPHGEKGPRGKPGLPGMPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPR
GIKGVDGIRGLKGHKGEKGEDGFPGFKGDMGVKGDRGEVGVPGSRGEDGPEGPKGRTGPT
GDPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGER
GPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPPGKD
GLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGETGPMGERGHPGPPGPPGEQGLTGTA
GKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPAGPPGPAGSPGER
GSAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVA
GEDGDKGEVGDPGQKGAKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAK
GDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPP
GGVGNLGPPGEKGEPGESGSPGVQGEPGVKGPRGERGEKGETGQAGEAGPPGPKGPTGDD
GPKGNPGPVGFPGDPGPPGEVGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKR
GPAGTPGPEGRQGEKGAKGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRP
GATGQAGPPGPVGPPGLPGLRGDTGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGST
GQKGETGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGEV
IQPLPIQMPKKTRRSVDGSRLMQEDEAVPTGGAPGSPGGLEEIFGSLDSLREEIEQMRRP
MGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVT
QFSYVDSEGAPVGVVQLTFLRLLSVSARQNISYPCSGEAQDSPLKLRGANEDELSPETSP
YIKEIRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSELGAPPRRGGVLLGPVCFMG
Download sequence
Identical sequences F1MRP6
ENSBTAP00000000793 ENSBTAP00000000793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]