SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000929 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000929
Domain Number 1 Region: 142-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-44
Family Dual specificity phosphatase-like 0.000095
Further Details:      
 
Domain Number 2 Region: 12-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.14e-26
Family Cell cycle control phosphatase, catalytic domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000929   Gene: ENSBTAG00000010763   Transcript: ENSBTAT00000000929
Sequence length 643
Comment pep:known_by_projection chromosome:UMD3.1:5:97754464:97806021:1 gene:ENSBTAG00000010763 transcript:ENSBTAT00000000929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDLDCSQKVVVYDQSSQDVASLASDCFLTVLLGKLEKSFSSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKRIKS
QTGAAGPKSKLKLLPLEKPSESVAGPGPVEGAQGSQLPPGPPHGRPAPALSEGAGPRPAP
PSTAPDDGPLVQALNGLHLPPDRLEDSGRLKRSFSLDIKSVTPTPGGLSSPEAALELYKP
AASSLEGAGKPCQFSPVQEVSEQTPEASPDSEEAPPPRPSDGSGQGARPRPGRPLWSPLH
RSGSVEDRGQPRFLFGLSASQQHLATSATGLGLEGWHSDLLAPQTSAPALTKSWYFAPEP
PHFYSASAIYGGRTGHPAFSCSQLPTCSGDPGHSVRRRHKPGDRADSRRSWHEESPFEKQ
FKRRSCQMEFGESIRSENRSREELGKVGSQSSFSGSMEIIEVS
Download sequence
Identical sequences E1BAA9
ENSBTAP00000000929 9913.ENSBTAP00000000929 ENSBTAP00000000929 XP_002687822.1.76553 XP_876068.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]