SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000941 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000941
Domain Number 1 Region: 329-628
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.62e-88
Family beta-glycanases 0.000000000113
Further Details:      
 
Domain Number 2 Region: 24-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.78e-61
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000000265
Further Details:      
 
Domain Number 3 Region: 226-328
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.88e-29
Family beta-Galactosidase/glucuronidase domain 0.00000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000941   Gene: ENSBTAG00000000704   Transcript: ENSBTAT00000000941
Sequence length 652
Comment pep:known chromosome:UMD3.1:25:28162569:28174955:-1 gene:ENSBTAG00000000704 transcript:ENSBTAT00000000941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGSAGAWAVLGPLLWGCGLSLLQGGMLYPRESRSRERKELDGLWSFRADFSDNRRQGF
EQQWYRAPLRESGPTLDMPVPSSFNDVGQDGQLRSFVGWVWYEREITLPQRWTEDLGTRV
VLRIGSAHYYAIVWVNGVHVLEHEGGHLPFEADISKLVQSGPLSSCRITIAINNTLSPHT
LPPGTILYKTDPSMYPKGYFVQNTKFDFFNYAGLHRSVLLYTTPTTYIDDITVTTDMDQD
IGLVNYQIIVQGSDHFQVDVSLLDEEGKVMAKGAGAEGQLQVPSAHLWWPYLMHEHPAYL
YSLEVKLTAQTAVGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFRGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYSEEVLQLCDRYGIVVIDESPGVGIVLVESFSN
VSLQHHLEVMEEMIRRDKNHPAVVMWSLANEPASFLKPAGYYFKTLIAHTKALDPSRPVT
FVTNTNYEADLGAPYVDIICVNSYYSWYHDYGHMEVIQLQLATQFENWYKAYQKPMIQSE
YGADAIEGFHEDPPLMFSEEYQKGLLQQYHVVLDQKRKEYVVGELIWNFADFMTNQSPVR
MIGNRKGIFTRQRQPKSAAFLLRERYWKLANETRYQRSAVTSQCVGSGLFTV
Download sequence
Identical sequences A3KMY8
ENSBTAP00000000941 ENSBTAP00000000941 9913.ENSBTAP00000000941 NP_001076905.1.59421 NP_001076905.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]