SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000958 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000958
Domain Number 1 Region: 223-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.38e-90
Family Eukaryotic proteases 0.000086
Further Details:      
 
Domain Number 2 Region: 847-1094
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.85e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 3 Region: 525-772
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-85
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 4 Region: 187-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 65-128
Classification Level Classification E-value
Superfamily SEA domain 0.00000719
Family SEA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000958   Gene: ENSBTAG00000000718   Transcript: ENSBTAT00000000958
Sequence length 1095
Comment pep:known_by_projection chromosome:UMD3.1:7:22458603:22488765:-1 gene:ENSBTAG00000000718 transcript:ENSBTAT00000000958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTASDLQLVPGATKDVLAADAMCCRAALSTVVATSIVLVILGVLVASLSTQGVDVEHM
AELRGIRFAPSLQQETSEYYRTLTPALEMLFVSSFQETELESSCLGCTVLSYWEGNASVL
VRFRLHFLLLALWTPSPGLEEQLLQRGLHARLQGLGIPLAPYGTIVSAQLTGSQKGPLTE
RDLKSGHCPGNVFSCGNSQCVTKVNPECDDTADCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENNEHFCGAAIISARWLVSAAHCFNEFQDSPEWVAYVGTTYLSGS
EASMVRARVARIITHPSYNSDTADFDVAVLELGRPLPFSRHVQPVCLPAASHIFPPRKKC
LISGWGYLKENFLVKPEMLQKATVELLDQALCTSLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEESSGRFFLAGIVSWGIGCAEAQHPGVYARVTSLRDWILETIASASKPPAPTV
ALASTTLSTAWPTSPKSLVTDTLTKPTLAPSTMPLDLATASKPQECGARPALEKPTRIVG
GLGASLGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAQLGTASLSGV
GGSPVKVGLRRVVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGRKC
VISGWGNTQEGNATKPDLLQQASVGIIDHKACSALYNFSLTDRMICAGFLEGKVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILATMSSHLLPTAPLP
TTRMPTSSHATRTTAGLTVPEVMASTPTPWATSRVTSQPADRTTTTVTSTPRGQTPLPPA
PKTTVGAQLPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLL
SAAHCFDVYGDPKQWAAFLGTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELVGP
VRRSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFY
PVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGVYT
RVAAVRGWIGQNIQE
Download sequence
Identical sequences E1B9Z9
XP_010805365.1.76553 XP_015319661.1.59421 ENSBTAP00000000958 ENSBTAP00000000958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]