SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001037 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001037
Domain Number 1 Region: 45-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000187
Family EGF-type module 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001037   Gene: ENSBTAG00000000783   Transcript: ENSBTAT00000001037
Sequence length 163
Comment pep:known_by_projection chromosome:UMD3.1:11:13969792:13984394:1 gene:ENSBTAG00000000783 transcript:ENSBTAT00000001037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRNPSHPGSFSTGVGTCGMSCCALNLSRMSSLSPADPPVAAAVVSHFNDCPDSHSQFCFH
GTCRFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIT
CVLIHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETGK
Download sequence
Identical sequences F1MWF2
ENSBTAP00000001037 ENSBTAP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]