SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001045 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001045
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 2.72e-53
Family Internalin LRR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001045   Gene: ENSBTAG00000000789   Transcript: ENSBTAT00000001045
Sequence length 360
Comment pep:known chromosome:UMD3.1:3:120853355:120869389:1 gene:ENSBTAG00000000789 transcript:ENSBTAT00000001045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKQNSGMVADLSAHSLKDGEERGDEDPE
EGQELPVDMETISLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEGLQ
SLRELDLYDNQIRRIENLDALTELEVLDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIE
NISSLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQSLVNLRELYLSHNGIEVIEGLDNNNKLTMLDIASNRIKKIENVSHLTELQE
FWMNDNLLDCWSDLDELKGARSLETVYLERNPLQRDPQYRRKIMLALPSVRQIDATFVRF
Download sequence
Identical sequences Q3T0W4
NP_001029410.1.59421 NP_001029410.1.76553 XP_010844813.1.44457 XP_019813612.1.53367 9913.ENSBTAP00000001045 ENSBTAP00000001045 ENSBTAP00000001045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]