SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001080 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001080
Domain Number 1 Region: 605-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-82
Family Protein kinases, catalytic subunit 0.00000000019
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-66
Family Ephrin receptor ligand binding domain 0.00000816
Further Details:      
 
Domain Number 3 Region: 328-527
Classification Level Classification E-value
Superfamily Fibronectin type III 2.29e-30
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 896-966
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.77e-19
Family SAM (sterile alpha motif) domain 0.00098
Further Details:      
 
Domain Number 5 Region: 257-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000044
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001080
Domain Number - Region: 526-559
Classification Level Classification E-value
Superfamily Inovirus (filamentous phage) major coat protein 0.0403
Family Inovirus (filamentous phage) major coat protein 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001080   Gene: ENSBTAG00000000815   Transcript: ENSBTAT00000001080
Sequence length 975
Comment pep:known chromosome:UMD3.1:2:136525537:136551769:1 gene:ENSBTAG00000000815 transcript:ENSBTAT00000001080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRAPPACLALLWGCALAAASAAQGKEVVLLDFAAAKGELGWLTHPYGKGWDLLQNIMN
DMPIYMYSVCNVVAGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDVDYGTNFQKRQFTKIDTIAPDEITGSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDVGACVALLSVRVYYKKCPELLKGLARFPETIAGSDAPALATVAGNCVEHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKPEASESPCLECPAHTLPS
SEGATACECEDGYFRAPQDPLSLPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDL
TYSVSCEQCWPESGECGPCEASVRYSEPPLGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVSTRSFRTASVSINQTEPPKVKLESRSTTSLSISWIIPPLQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTVYLVQVQALTQEGQGAGSKVHEFQTLSTGGSGNMAVVGG
VAVGAVLLLVLAGIGFFIHRRRKSLRTRQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGTLKASGKKEVPVAIKTLKAGYTEKQRVDFL
SEASIMGQFSHHNIIRLEGVVSKYKPLMIITEYMENGALDKFLREKDGEFSVLQLVGMLR
GVAAGMKYLANMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPI
RWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMD
CPSAIYQLMMQCWQQERTRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGS
EGVPFRTVSEWLESIKMQQYTEHFLVAGYTTIEKVVQMTNDDIKRIGVRLPGHQKRIAYS
LLGLKDQVNTVGVPI
Download sequence
Identical sequences E1BJ31
NP_001192660.1.59421 NP_001192660.1.76553 ENSBTAP00000001080 ENSBTAP00000001080 9913.ENSBTAP00000001080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]