SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001158 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001158
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-69
Family SPRY domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.11e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001158   Gene: ENSBTAG00000000871   Transcript: ENSBTAT00000001158
Sequence length 513
Comment pep:known chromosome:UMD3.1:23:29906624:29920511:1 gene:ENSBTAG00000000871 transcript:ENSBTAT00000001158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSVAECLQQETTCPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSNLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences K7GND2 Q1LZA9 W5Q7H3
9823.ENSSSCP00000001288 NP_001069267.1.59421 NP_001069267.1.76553 XP_003128283.1.46622 XP_004019073.1.66739 XP_005905030.1.15283 XP_006066926.1.26621 XP_006215303.1.17985 XP_012014215.1.54773 XP_017894007.1.57651 XP_019840822.1.53367 XP_020746022.1.74333 ENSOARP00000018665 ENSBTAP00000001158 ENSSSCP00000029385 ENSBTAP00000001158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]