SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001189 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001189
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 1.96e-55
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 231-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-25
Family Laminin G-like module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001189   Gene: ENSBTAG00000033515   Transcript: ENSBTAT00000001189
Sequence length 476
Comment pep:novel chromosome:UMD3.1:23:3946457:4067555:1 gene:ENSBTAG00000033515 transcript:ENSBTAT00000001189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHHITFLWIISILLLQNSVLAEDGEIRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGSHESGENLMAAMESIHYLGGNTRTGKAI
QFALDYLFAKSARFLTKIAVVLTDGKSQDEVKDAAEAARDSRITLFAIGVGSETEEAELR
AIANKPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDEKGFDILLGLGIK
KKAKKRVQLLPTKIKGYEITSKVDLSEFTSNVFPEGLPPSYVFVSTQRFKVKKMWDLWRI
LTIDGRPQIAVTLNGVDKTLLFTTTSIINGSQVVTFADPRVKILFDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPVLGIFISGQTQIGKYSGKEETVQFEVQKLRIYCDPEQNNRETY
FEICSHNGECLNGPSDVGSTAAPCICPPGKPGLQGPKGDPGQPGNPGYPGRPGQDG
Download sequence
Identical sequences E1BGN5
ENSBTAP00000001189 ENSBTAP00000001189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]