SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001294 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001294
Domain Number 1 Region: 341-497,542-585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-46
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001294
Domain Number - Region: 112-160
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001294   Gene: ENSBTAG00000000978   Transcript: ENSBTAT00000001294
Sequence length 629
Comment pep:known_by_projection chromosome:UMD3.1:27:32989769:33014982:1 gene:ENSBTAG00000000978 transcript:ENSBTAT00000001294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGSGPGLGVSAGPGPAAAANATPAEEGETKQAAAVAAAPAGEGTSAAPASAEPGSGE
AESGDANSVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGI
CTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQ
SRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEH
PDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAK
RKQQDGSTAGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE
LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKG
AWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG
YGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHS
EIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGW
GAVVEHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences E1BEP4
NP_001192402.1.59421 NP_001192402.1.76553 XP_010837081.1.44457 XP_019809072.1.53367 9913.ENSBTAP00000001294 ENSBTAP00000001294 ENSBTAP00000001294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]