SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001495 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001495
Domain Number 1 Region: 55-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.26e-46
Family beta-glycanases 0.039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001495
Domain Number - Region: 547-670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00344
Family Laminin G-like module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001495   Gene: ENSBTAG00000001124   Transcript: ENSBTAT00000001495
Sequence length 685
Comment pep:known_by_projection chromosome:UMD3.1:10:100733238:100789765:-1 gene:ENSBTAG00000001124 transcript:ENSBTAT00000001495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERLIQASWQRRAKAMTAAAGLAGQAAVPLLLCALLAPSGAYVLDDSEGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYIVTWIV
GSKHYHDLDIDYIGIWNERAFDINYIKVLRRMLNHQGLQHVKIIASDNLWEPISASMLLD
PELLKVIDVIGAHYPGTLTVKDARLTKKKLWSSEDFSTVNGDMGAGCWGRILNQNYVNGY
MTSTIAWNLVASYYQQLPYGRCGLMTAQEPWSGHYVVEAPIWVSAHTTQFTQPGWYYLKT
VGHLERGGSYVALTDGLGNLTVIVETMSYKHSKCIRPLLPYFNVSHQFATFDLKGSFSQI
QELQVWYTKLGKPSERFLFKQLDSLWLLDSGGSFTLELQEDELFTLTTLTSGRKGSFPPP
PKSQRFPSVYEDNFNIDYPFFSEAPNFADQTGVFEYYVNMEDPGDHRFTLRQVLNQRPIT
WAADAFNTISVIGDYSWSNLTIKCDVYIETPEKGGVFIAGRVNKGGILIRSARGIFFWIF
ANGTYRVTGDLAGWIIYSLGHADVTAKKWYTLTLTLNGRFSSGKLNGKTLWKNISVNFPE
NGWAAIGTHSFEFAQFDNFRVEASH
Download sequence
Identical sequences E1B7K0
9913.ENSBTAP00000001495 ENSBTAP00000001495 ENSBTAP00000001495 NP_001192949.1.59421 NP_001192949.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]