SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001511 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001511
Domain Number 1 Region: 610-812
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000012
Family Mannose 6-phosphate receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 30-69,233-281,334-362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000133
Family Growth factor receptor domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001511   Gene: ENSBTAG00000001136   Transcript: ENSBTAT00000001511
Sequence length 968
Comment pep:known_by_projection chromosome:UMD3.1:3:34313872:34353121:-1 gene:ENSBTAG00000001136 transcript:ENSBTAT00000001511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFSPLQSEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCKAGEFLDMKD
QSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSTNMEIEDSTLESTENCTSSKWVPLGDY
IASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPNADDSRWMKTTE
KGWEFHSVELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPGTYAD
QQGSSSCKLCPANFYSNKGETSCHQCDPDKYSEKGSSTCKARPACTDKDYFYTHTACDAN
GETQLMYKWAQPKICSEDLEGAVKLPASGLKTGCPPCNPGFFKTNSSTCEPCPYGSYSNG
SDCSHCPAGTEPAVGFEYKWWNTLPTNMETTVLSGINFEYRGMTGWEVAGDHIYSAVGAS
DNDFMILTLVVPGFRPPQSVMADTENKEVARITFVFETICSVNCELYFMVGVNSRTNSPV
ETWKGSKGKQSYTYIIEENATMSFTWAFQRTTFHETGRKYTSDVAKIYSINVTNVMDGVA
SYCRPCALEASDMGSSCTSCLAGHYIDRDSGTCHSCPPNTILKAHQPYGAQACMPCGPGT
KSNKIHSLCYNDCTFSVSTSTRTFEYNFLALEKTVSLAGGPSFTSKGLKYFHHFTLSLCG
NQGRKMSVCTDNVTDLRIPEGESGFSKPITAYVCQAIIIPPEVTGYKAGVSSQPVSLADR
LIGVTTDMTLDGITSPAELFHPESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPLKP
APGSLSLPSKCSDGTCDGCNFHFLWESVAACPLCSTADYHAIVSSCVAGIQKTTYVWREP
KLCSGGISLPEQRVTICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLV
MNATLKDCDLPAADSCAIMEGEDVEDDLIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTS
SGGPDMDL
Download sequence
Identical sequences F1MIM6
ENSBTAP00000001511 ENSBTAP00000001511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]