SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001557 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001557
Domain Number 1 Region: 37-184
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 3.66e-29
Family Ribosomal proteins L15p and L18e 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001557   Gene: ENSBTAG00000001174   Transcript: ENSBTAT00000001557
Sequence length 297
Comment pep:known chromosome:UMD3.1:14:23675383:23680928:1 gene:ENSBTAG00000001174 transcript:ENSBTAT00000001557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPVRGAAGPWALDLLRALPRVSLANLRPNPGSRKPERRRRGQRRGRKCGRGHKGERQR
GTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRRQYQPLSLNRLQYLIDLGRVDPTQPIDLT
QLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQLASELAIAAIEKNGGVVTTAFY
DPRSLEILCKPIPFFLRGQPIPKRMLPPEALVPYYTDARNRGYLADPARFPEARLELAKK
YGYILPDITKDELFKMLSSRKDPRQIFFGLAPGWVVNMADKKILKPTDEKLLEYYSS
Download sequence
Identical sequences L8IRT2 Q0VC21
ENSBTAP00000001557 9913.ENSBTAP00000001557 ENSBTAP00000001557 NP_001068913.1.59421 NP_001068913.1.76553 XP_005892061.1.15283 XP_010837263.1.44457 XP_019829506.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]