SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001560 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001560
Domain Number 1 Region: 34-406
Classification Level Classification E-value
Superfamily L domain-like 2.49e-61
Family Ngr ectodomain-like 0.082
Further Details:      
 
Domain Number 2 Region: 425-516
Classification Level Classification E-value
Superfamily Immunoglobulin 7.17e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 527-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000272
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001560   Gene: ENSBTAG00000001176   Transcript: ENSBTAT00000001560
Sequence length 716
Comment pep:known chromosome:UMD3.1:22:22576210:22578360:-1 gene:ENSBTAG00000001176 transcript:ENSBTAT00000001560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMSFVLAAYQMVLSLLMTSLTGSSLQSSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMNDYCLQDLSNLQELYINHNQISTISANAFSGLKNLLRLHLNSNKLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLSNLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAVYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYRGQQVKEVLIQDSSE
QCLPMISHDTFPNHLNMDIGTTVFLDCRAMAEPEPEIYWVTPLGNKITVETLSEKYKLSS
EGTLEISKIQIEDSGRYTCVAQNVEGADTRVVMIKVNGTLLDGAQVLKIYVKQTESHSIL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYIAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGTADTKPTQVDTSRSYYMW
Download sequence
Identical sequences A0N0X6 L8IIB7
9913.ENSBTAP00000001560 ENSBTAP00000001560 NP_001074207.1.59421 NP_001074207.1.76553 XP_005222725.1.76553 XP_005222726.1.76553 XP_005896226.1.15283 XP_006074655.1.26621 XP_006074656.1.26621 XP_006074657.1.26621 XP_010842427.1.44457 XP_019840399.1.53367 XP_019840400.1.53367 ENSBTAP00000001560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]