SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001642 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001642
Domain Number 1 Region: 302-564
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.99e-86
Family Eukaryotic proteases 0.00000000222
Further Details:      
 
Domain Number 2 Region: 107-211
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 217-303
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-30
Family Kringle modules 0.0000389
Further Details:      
 
Domain Number 4 Region: 37-86
Classification Level Classification E-value
Superfamily FnI-like domain 3.14e-19
Family Fibronectin type I module 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001642   Gene: ENSBTAG00000001244   Transcript: ENSBTAT00000001642
Sequence length 566
Comment pep:known chromosome:UMD3.1:27:36738833:36762837:-1 gene:ENSBTAG00000001244 transcript:ENSBTAT00000001642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSAMKTEFLCVLLLCGAVFTSPSQETYRRLRRGARSYKVTCRDGKTQMTYRQHDSWLRP
LLRGNQVEHCWCDGGRAQCHSVPVRSCSEPWCFNGGTCRQALYSSDFVCQCPEGFMGKLC
EIDATATCYKDQGVAYRGTWSTAESGAECANWNSSGLAMKPYSGRRPNAIRLGLGNHNYC
RNPDQDSKPWCYVFKAGKYISEFCSTPACAKVAEEDGDCYTGNGLAYRGTRSHTKSGASC
LPWNSVFLTSKIYTAWKSNAPALGLGKHNHCRNPDGDAQPWCHVWKDRQLTWEYCDVPQC
VTCGLRQYKRPQFRIKGGLFADITSHPWQAAIFVKNRRSPGERFLCGGILISSCWVLSAA
HCFQERYPPHHLKVFLGRTYRLVPGEEEQTFEVEKYIIHKEFDDDTYDNDIALLHLKSDS
LTCARESASVRTICLPDASLQLPDWTECELSGYGKHESSSPFFSERLKEAHVRLYPSSRC
TSQHLFNRTVTNNMLCAGDTRSGGDHTNLHDACQGDSGGPLVCMKDNHMTLVGIISWGLG
CGRKDVPGVYTKVTNYLDWIRDNTRP
Download sequence
Identical sequences Q28198
ENSBTAP00000001642 ENSBTAP00000001642 9913.ENSBTAP00000001642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]